SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI256594 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI256594
Domain Number 1 Region: 10-246
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.01e-87
Family Calponin-homology domain, CH-domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 263-382
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-32
Family Spectrin repeat 0.00013
Further Details:      
 
Domain Number 3 Region: 551-695
Classification Level Classification E-value
Superfamily Spectrin repeat 3.54e-31
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 4 Region: 1360-1516
Classification Level Classification E-value
Superfamily Spectrin repeat 8.77e-30
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 5 Region: 656-779
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-29
Family Spectrin repeat 0.00062
Further Details:      
 
Domain Number 6 Region: 930-1068
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-24
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 7 Region: 1125-1248
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-21
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 8 Region: 379-494
Classification Level Classification E-value
Superfamily Spectrin repeat 6.28e-16
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 9 Region: 830-889
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000197
Family SH3-domain 0.001
Further Details:      
 
Weak hits

Sequence:  7739.JGI256594
Domain Number - Region: 1514-1541
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0368
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number - Region: 1067-1140
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0615
Family MukF C-terminal domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI256594
Sequence length 1543
Comment (Branchiostoma floridae)
Sequence
MDGVSQFEKGRIQALQQERIHIQQKTFTKWINSFLEKNSVAVGELFKDLQDGVLLLQLLE
IISNERLPRASRGRLRVHKIENVNKALKFLKDKRVKLESIGAEDIVDGNPRLTLGLIWTI
ILRFQIQDIKLEEEESNEKRSAKEALLIWCQRKTAGYRSCKVDNFTTSWSNGLAFNALIH
AHRPDLINYDRLNPSEHINNLNNAFSVAQERLGISRLLDAEDVDIAKPDEKSIMTYVAAY
YHYFAKMKSEQTGSKRIAKIMDFQIEIDRMKTDYERMVEALLEWISEKQEQLDSRQFPNT
LEGVQRETTKFKQYRTIEKPPKYNERGLIEAQFFDIQTKLRANNQRPYVPPEGRMLNDVE
RAWQQLESSEHAREIALREETSRQERLQQLAGKFERKALLRETYVKDMDRVLDERYFVVK
DSASVEAAIKKHEAISADLLPRKERFSMLSQMANELWKENYHRKEEVKGREDTIVQKWSQ
LLQLVERRGQTLANFKDLMDMFREMESINAEIKEIEGQVQSEDCGKHLFGVEDLLQKHQL
MEAHVKSLGQRVDRVNVKGNGFIGSQHAESATIQKKLEDVSANYDRLKTRSGIRRSKLED
GLNHYEFLRDTEEEEGWVMEKQRIAKSVVTGKDLHSVLSQQQKHKALEAEMAARHPQLEA
VCERGQALCDSKHPHRREIGIKVKGLQEKWDRLKDLAVSRRIRLEQAVLAHQYYTDGNEA
ESWMREKMPLVCSEDYGKDVQSAQSLLQRHGYLEEEIRAYESGIQKLGEQAQHMIDSGTM
NQLQSTNSPSINGEPDEDQYLEELVEVPYEVEVEKTVEREAVREVVEDRKVPQVKAMYKY
SGKGMSVDRGQVLVLTSKTNKDWWCVRRPDGVEGYVPANYVKEVEGKVVQKKVKRKVKVP
EKVKVKEVKTRKELVKRKNPLYSKASAETSVHFDRDNLEERQQNISATYRRLVKLAQARR
RYLEDSIQLFGFYRECDEFESWMQDQEKVMKSVESMKDNVEAMKRKFENLMTALAANAGR
MKKIDQLADEFVKTGHSQQKPVRARQKELKERWERLHQLQRDKEKLLEGASSIELFERTC
DDTKEWMQEKFAALSNDDLGNSVKGVKALQRQHQNLERELGPVEDKISKLQLLATAVKTA
HPSENAPITLKEERILNMWQQLKDKASLRKAQLAQSHDTQKFQAENKDLMSWLSSVKEQL
KSEELARDVLHAEELIKQHQELKDDIAAHQDSFKELQRLGERLLRKAPTNRDLRRKVELL
KQEQQNLQAAWSSREEQLRDSHELQLFHREADQIDSVTGSHEAFLEFDELGVCLISYLSC
LNIYFWIKAATDESYRDLTNLQGKLQKHEAFEAELRANTERLDRANQAGKALVAERHYAR
KEIQETLRDLNTQWADLYDRSSDKGVKLRQAAQQQQLNTLLREAQDRMDEMEVLLGVQDL
GKDLRGARNLLKKHQALEQEMSQQAEKIQSIVSQAQALARAGHFDAKRIMQNTKDFQQRF
QSLQAPMLRRRGELEDSVRLQEFLRDLDEEMRWIRDHMPAATS
Download sequence
Identical sequences 7739.JGI256594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]