SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI257879 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI257879
Domain Number 1 Region: 119-223
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00026
Further Details:      
 
Domain Number 2 Region: 11-118
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI257879
Sequence length 223
Comment (Branchiostoma floridae)
Sequence
MQRVNVCYITGLKRVRLVGGSVPNEGRVEVRPENSFNWSTICRDHFDIRDAEVVCRMLGY
VRANRVYNLAPGNQGVGPIAMDDLRCAGNETSLFNCSYPGWGIHDCRHYQDVGVVCDPSR
VRLIGGSGENEGRLEVRPANSFTWGTVCQDDFDRRDAAVVCSMMGYSKAIQVRNDSDFGL
GTGPIYMDDLQCAGDESSLFECSYPGWGIHDCDHSQDAGVVCT
Download sequence
Identical sequences 7739.JGI257879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]