SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI275843 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI275843
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.92e-67
Family Calponin-homology domain, CH-domain 0.0000209
Further Details:      
 
Domain Number 2 Region: 203-325
Classification Level Classification E-value
Superfamily Spectrin repeat 3.35e-33
Family Spectrin repeat 0.00000131
Further Details:      
 
Domain Number 3 Region: 439-560
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-26
Family Spectrin repeat 0.0000119
Further Details:      
 
Domain Number 4 Region: 326-435
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-22
Family Spectrin repeat 0.00000774
Further Details:      
 
Domain Number 5 Region: 674-824
Classification Level Classification E-value
Superfamily EF-hand 1.96e-21
Family EF-hand modules in multidomain proteins 0.0091
Further Details:      
 
Domain Number 6 Region: 564-674
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-20
Family Spectrin repeat 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI275843
Sequence length 828
Comment (Branchiostoma floridae)
Sequence
MLLLEVISGERLPKPDRGKLRFHQIANVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLG
MIWTIILRFAIQDISVEESSSKEGLLLWCQRKTAPYKNVNVQNFHTSWKDGLAFCALIHR
HRPELIPNYNELRKDDPIGNLNLAFEIAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSC
YYHAFSGLQKAETAANRICKVLRVNQENERLMEEYERLASDLLEWIRKTIPWLENRTRDN
TLPGTQHKLEEFRDYRRKHKPPKLEDKSKLEIIFNTLQTKLRLSNRPAYMPSEGKMVADI
ANAWKKLEFAEKGFEEWLLAELRRLERLDHLARKFKHKSDIHEEWTEGKEVMLQDTDFKN
CNLYELKALRKKHEAFESDLAAHQDRVEQIAAIAQELNDLEYWDVVTINARCQRICDQWD
RLGALTQKRRNALDEAEKILERVDQYHLEFAKRAAPFNNWMDGAKEDLVDMFIVHTMDEI
QGLIDAHEAFKMTLPEADKEFNAIMMCITEVQRIVQQLDLKGVTINPYTNITGEELKQKW
QDVNNLVPQRDSVLQQEMVRQQNHERLRRQFAQKANSVGPWIEKQAEAIATIGMQMQGTL
EDALLKLKNMEAQIMAYKPNMDELETYNQAIQESLVFENKHTQYTMETLRVGWEQLLTSI
ARTINEVENQILTREAKGIPEEKLQEFRASFSHFDKDGSGRLEPNEFKSCLISIGYNIQE
GDKGDAEFAHILGVVDPNGSGYVTFQAFLDFMTRETTDSDTAEQVMQSFKILAGDKPYIT
QEELRRELPPDQAEYCIARMTQYTGPDGIPGALDYMSFATALYGESDL
Download sequence
Identical sequences 7739.JGI275843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]