SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI59003 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI59003
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.41e-44
Family Calponin-homology domain, CH-domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI59003
Sequence length 187
Comment (Branchiostoma floridae)
Sequence
MSNRGPLYGLSAEIARKQAAKYDHDLERQVRLWMGEILGEPFPDAGFQEAMKDGTLLCNL
INKLEPGSVKKIKTSKVPFMQMENISQFLQAAERYGLKRTDLFQTVDLYEGKGMNAVLDC
LLALASQAKTKGVVTQSNPGVKVAAKNERNFSEEVLNQSKMEISLQYGSNKGATQSGMTA
PGTYRHL
Download sequence
Identical sequences C3YQR6
XP_002601410.1.56174 7739.JGI59003 7739.JGI61874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]