SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI63318 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI63318
Domain Number 1 Region: 178-308
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000297
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI63318
Sequence length 1021
Comment (Branchiostoma floridae)
Sequence
MSEELQTRQTDTVDGPTVPDIVPLTEYDPFRAKVHASMLWAIGKAYGGMVPPELQWPFFT
DDEGTEQLTPLLVGMLTAGELYCMICTQMFREPCDWGGHWSVIQALSRRGIQAMEDEENG
VSQENLQEAQPINLKSHLAVLDALMEAYINEVISIEGVVTAVKKFATFNASQELPYDMED
ALLFWLNKVGRTLQDRRGSKKANDPEGGDPSGWDLPTLDDILKDLSDGRVLLAVLCFYCP
NHIRPEDGQLGSLISMSESVRNLSLVRRFCDQHLGAMFHLSYEDVLYSPEVLKPNIKAFI
AELFWWLEVIRPDIVQPALTNHQQTIPLEAEMSSTPTRARPRPNVPISKATKRSFQTPDR
DSPSNLSITPSHSSPDISRHTPLLALRHRAKQNSQQGEGEEVLHPLRRSNSLNSASDASV
KGSVMAWPEVANSNGGLPRPAAGIPIIDDNVVGRASVDEEGNPGNAEDAGDVVESPKLHS
ETLDKESLQKESIPRESLQMDFLQRDHSVPIQTWGKGDKNCSNGNGVPTATTPQEVKVAT
SGHVTTWGRNRASRGSTPEEQENGHGTQPLASQMVKLRLKLEEKRRTIENEKKKMELQWN
RQRQRVGKAAFLHVISQKKAPTPTKEPPPENYHYDREDNNGRIRFDKNEVSGPCMTGFAS
ANSAIPEEVVTEVNREPAFAPKQSHDIPMSPNEATSPGEVIDLNEYNTSLERLNSDLSLI
QKEIARLSQHQDTLKSQSSPPAKERVPSSPRVKPVVSKSSPKSKEKNVSSTPKLTHANVA
GTVSIPSSVSSNQSRSSKKQQGRVTVMEASPTIEHVQHRRLAASQSDQTLGLGSSGPQFE
AEIPRSESEQGPTTSHVNHENSAVNVQTTYDSTVEQWAMTGEVCKPEDSREEAVLPESPG
AEGKAAAVGFFSFNSADADKTKEEEMSRKREQFLRARMKREEQLKARQMEREAEQERERE
ERKRRQEEAEQRKAEEKARKELIYQEYQRRKHEQEMAQQQQRKGARPKKSRPKRLPAGEC
C
Download sequence
Identical sequences C3ZSH7
XP_002588368.1.56174 7739.JGI63318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]