SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI82466 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7739.JGI82466
Domain Number - Region: 41-111
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000278
Family Calponin-homology domain, CH-domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI82466
Sequence length 968
Comment (Branchiostoma floridae)
Sequence
MDSASSSSSASGGADEEWIELANSLLKKVHLLLRVRQLTDCDGHLLVSLYEGILGDKPPD
CIVDPLTKEDHIHNVQSVIDSLALDYLHVNLSHITGEGVVSGDSESIRNLLEIFEGLFEY
LAEEIESDSEQEDEGAPQDPYAFSQQGQSIITDVLDQELGTSHRTERPAPPATVSAAPVQ
DSLEEGSTDDLIELGDSRYVHTRSPVRPTATRLEDTYSKATTSQPTTVPSTVPSTSVSVQ
PPPTTNITPSAIPTPILPTTRPEDTSDLRRISTVPPSIAIPISVTRTPTHRDVGDINTTL
PSRRIPTYSNAVEPPLVPITSTRPTKEPQPYVGELSQGLGVTQPLIGEERLVGQREELES
QSAIRTHRDAERDQTAPKRVHFTDGTGRTPTRKTAGMDRRRDGEEEERRMEEEEEVLDHQ
RRLRQLEEFLERSREEVRRLMVREDEELSQHSDSAVDYETELPVGRQTPVVCVMFSIFLS
EEVRRLMVREDEELSQHSDSAVDYETSGRQTPVVVCNVLYFLVRSEEVRRLMVREDEELS
QHSDSAVDYETDRHHEEVRRLMVREDEELSQHSDSAVDYETDTDTSGETDTSSTPVSRGT
SRLADEGNERRRKRSRSASPTTPVRADDTLTVKDNDLLPVLMEEFPFLHVSPHTMANMFV
YMFVYMLFTVTVKDNDLLPVLMEEFPFLHVSPHTMANMFVYMFVYMLFTVTVKDNDLLPV
LMEEFPFLHVSPHTMANMWRRQMKQIEQITKMSEPVSKRTKTQKQFEDAKKRQETMLKIL
DKERQHQQRMKELRDRSKQQRQVHRAVQQKRQQSARARRYYDEYQVRMRAKMLKRKTREE
QIFKKLFEEGLGIQKTRIRDLRQYAKEKRDHVAQRQQDELESMENYYRDQFSMLAETLTR
ERYELQIRDKAQAKVLEKMRRELRQKMEQEIKGLQEQLTRDEDDAYFRQLEADRLRRQLN
FARYQTRL
Download sequence
Identical sequences 7739.JGI82466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]