SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI83070 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI83070
Domain Number 1 Region: 99-186
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-22
Family Caspase recruitment domain, CARD 0.014
Further Details:      
 
Domain Number 2 Region: 258-345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000153
Family I set domains 0.02
Further Details:      
 
Weak hits

Sequence:  7739.JGI83070
Domain Number - Region: 1-91
Classification Level Classification E-value
Superfamily DEATH domain 0.000137
Family Caspase recruitment domain, CARD 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI83070
Sequence length 353
Comment (Branchiostoma floridae)
Sequence
MTRHHQEMLKVYRLDVVIHVQNPDRITAFLASRKVRLPTGMSPIKEPLTVEDRNKVLLDN
LTFGEDDAFEGYCAALREEEKLYWLADTLEGPGLSVDLREQLMRHQIVLVEKMDPDITLA
HLSKQKVFTEAMTEYVSSADSREEKNRRIVHLLQSRDDPDFFTFCEALRENQGQAHLWDL
LQGKTRSEATGQQVDATGHGVDSERMEETQREDSHQVERQPAETPRSHLAMTADGGAIGD
QRREGEPIPMQLSLADPSIRSGTSAVVRTGLPVILTVNGEVDDAHWLLNNESLPLNKGIH
TRTSGLTHELEIDNMTSDLAGTYTCQGTTPKGAMLSCDIKLTLLDPSPSLSSS
Download sequence
Identical sequences C3ZTT3
7739.JGI83070 XP_002588070.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]