SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI84939 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI84939
Domain Number 1 Region: 204-279
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-22
Family Kringle modules 0.00048
Further Details:      
 
Domain Number 2 Region: 96-199
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-18
Family C-type lectin domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI84939
Sequence length 281
Comment (Branchiostoma floridae)
Sequence
MPWSRQANRRVPNTGEGLTSQRPSTEQHRDRLRQQDHRTVRRNVRTWKGRRGLTKEGSSH
RKKKCPDVEREARTDEGSFKGKVVHRGQTGVCRGRGLLAIPKNQDLDFFLWKLTNFVDDY
FWFGLSDEEREGEWMRADGTVADVTGFRSPYSWANWLPGEPDASAFGGLEDCALYNRGII
GWDDAMCHHPQKFICQLTQLCPEKSIGSEYRGTLSVAISGKTCQRWDTNSPHDHEKYWPW
TNPDLTENYCRNPERRELSVWCYTTDPRTHWEYCTNPLCLI
Download sequence
Identical sequences C3ZQC2
XP_002589167.1.56174 7739.JGI84939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]