SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI84958 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI84958
Domain Number 1 Region: 23-148
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-47
Family Calponin-homology domain, CH-domain 0.0000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI84958
Sequence length 154
Comment (Branchiostoma floridae)
Sequence
MTTDINQRWGETVQHDIDDWDENSSARLFERSRIKALADEREMVQKKTFTKWVNSHLARV
NCRITDLYTDLRDGRMLLKLLEILSGERLPRPTRGKMRIHCLENCDKSLQFLKEQRVHLE
NMGSHDIVDGNQRLTLGLIWTIILRFQVRAHSLC
Download sequence
Identical sequences C3ZQA3
XP_002589148.1.56174 7739.JGI84958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]