SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI86805 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI86805
Domain Number 1 Region: 70-175
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.89e-25
Family Calponin-homology domain, CH-domain 0.00066
Further Details:      
 
Domain Number 2 Region: 576-656
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-22
Family DIX domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI86805
Sequence length 718
Comment (Branchiostoma floridae)
Sequence
MANESSVSSFTDCRQRTPNVCCFCHKPGAQHVLVKEVSRSEAQPQSVFIMAEGPPRGQAE
SQSWAEWTEQLQAYVAWVNSQLKKRAGCRIVSDLRRDMQDGVAFAQLVEILSGETLPHVD
YSPKCLGTMKQNVEIVLQFMQTHRIRMHQTSAKDIVEGNLKAVMRLILALAAYFKPSSVK
SSAQQHSRSQQRNTSVAAAAGAAAALADARKDAASAGRQYHSRREPRSHGDAGHHRSPAS
TPDRQPPRYEDLVRSPPASMSPQSRPPTQEPDVLPRRDSDTTQGLSSGDEGSRASWQELL
EQHLDLESQMEEAKETVVKLQHLLLQGEEEGEGVRQLLEGVNPEEQVVLLQSRLDQREVE
CDHLRKDLSRAKQENMNLHGTKVGLQSRLTEQDSSLLEMKNELLRLGFVMEQFEADKAEL
QRKVDDKNKMLTDLRRQLTEKDRQLDEQQAKLEEAERKLSQANSSKTKDSVSSPVYNGVP
ALPPGEELQVVREALRGLRSCFQVNNPQHHTIDTLEQSIATLMERLRFLESQRLIASQKE
SLANRVKPASPKSQDSALSPTSRQRSNGVESNGSTQGTKILYFTEKTVTPFMTSISKKLG
DITLRDFKEVFDRQGSFRFHFKALDPEFGTVKEEVCQDEDIIPGWEGKIVAWIEECFRKW
QSTEQDSKHETVWSHEVEEMAVLNSSSKCYGGQGLIPDEMPAVKRACSCLLCPREHGT
Download sequence
Identical sequences C3Y2N2
XP_002609284.1.56174 7739.JGI86805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]