SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI89384 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI89384
Domain Number 1 Region: 50-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.11e-27
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 
Domain Number 2 Region: 225-299
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.44e-26
Family GAS2 domain 0.0000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI89384
Sequence length 307
Comment (Branchiostoma floridae)
Sequence
MQTPVQHRQLRSASRSRAESDRLDSVSSDVSIMDTDLDMDPFAQHFSALQEAALVPMKED
LADWLNRLLGINVSVDNFMEVLESGVVVCQLANFIQQKAQQQAATARGGGDSAIPKPVRC
FKNAKAGSFFARDNAANFLTWCRNLGVSDACLFESEGLVLQKQPKEVCLCLMELARLASH
KYGIDPPGLIQLEKEIEQEEVKEVVVPRKVSAPRSPKKRQKTAGTLDDEVQRISGTCQCH
HTPFSLERLSEGRYRIGDKIVFIRMLRGRHVMVRVGGGWDTLQHYLMKHDPCKMIIVGRD
GGKMVLW
Download sequence
Identical sequences C3ZHT7
XP_002591870.1.56174 7739.JGI89384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]