SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7739.JGI95792 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7739.JGI95792
Domain Number 1 Region: 34-129
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.5e-18
Family Calponin-homology domain, CH-domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7739.JGI95792
Sequence length 368
Comment (Branchiostoma floridae)
Sequence
MEDGDDVDAKRASFSHVGMTEERQSAEEMDEKRQQAMAYEYLCHLQEAKQWMEACIREEL
PATTELEEGLMNGVILGKLAHFFAADIVPIKKLYDIDQSRYQAKGLHFRHTDNINHWLRA
MEKVGFPKLSEDDAALHAAIIAINDAIEKQVSADTLTALQNPAARMKQVQDHLADSYQEQ
LYTMKTAKEEKAAAQAEREEVNEADQDVYDRLLTQAEIQGNVNQVNLRAGVDKVNAALDA
GDEMALIEALQAPGLGLAAIKKDNATWYLDELSRLRQEKGQLLDKDDIHKSVEQANNAAD
TRTKRDEAIKAINMAIDSGSTTELMSALKRADAQLPPVEEHGTQLYLAGLTNLKNKKDGV
CALPTILA
Download sequence
Identical sequences C3YQ64
7739.JGI95792 XP_002601556.1.56174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]