SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 78245.Xaut_1731 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  78245.Xaut_1731
Domain Number 1 Region: 18-171
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.09e-37
Family Ricin B-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 78245.Xaut_1731
Sequence length 172
Comment (Xanthobacter autotrophicus Py2)
Sequence
MLNWHGAFRGAASVCTIVVCMAAFTVPAVAAPPPSGRVQIANANSDLCLSPAGGTGNQNE
QTVQYHCDTHPSRAWVIEPVEGNIVKIRNVNSNLCLTVAGGNSDRNTPSVQYSCDDHPSR
RWLYAPFDGGLFRLVNVNSGLCLTIAGGSTGLNQTAVQFPCDEHPSRFFRLK
Download sequence
Identical sequences A7IG33
gi|154245675|ref|YP_001416633.1| 78245.Xaut_1731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]