SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000007758 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000007758
Domain Number 1 Region: 241-437
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-46
Family DBL homology domain (DH-domain) 0.000000287
Further Details:      
 
Domain Number 2 Region: 430-556
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-30
Family Pleckstrin-homology domain (PH domain) 0.0000241
Further Details:      
 
Domain Number 3 Region: 1-114
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-24
Family Calponin-homology domain, CH-domain 0.0012
Further Details:      
 
Domain Number 4 Region: 166-235
Classification Level Classification E-value
Superfamily SH3-domain 3.81e-23
Family SH3-domain 0.0000586
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000007758
Sequence length 767
Comment (Danio rerio)
Sequence
MNPEEQTVTWLITLGVLNSPKKNIADPEEFLKTSLRDGVVLCKLIERVLPGAITKYSAEP
KCEADCIANIREFLKGCQSLKVEGFDAESLYSGENFNRVLSTLSAINIATQVQLQQQNCS
RSCPQSNTSTSSLSTPSQAAPTLKSSRSLRRQSKAVEMSENGGGGQLVVKARFNFKQNNE
DELSFSKGELIHVTRQEEGGWWEGTLNSKTGWFPSNYVREVKPCDKPISPKAIKGFDVPQ
LTKNYYSVVVQDILEHEREFVKELQNVLGGYLRPLQASDKLSSVDCSSLNGNLEDILSFQ
QGLCLTLEECSKVPEGQQRIGGCYLNMMCQIRTLYLSYCSSHPSAVCVLTDHRNSEELDK
FMESQGASAPGILTLTTSLSKPFMRLDKYPTLLQELERHVEEAHPDYSDILKATAAFKNL
VTQCQDLRKRKNLELQILSEPVRGWEGDSMKSLGQVIYMSQIHMQSSANEEKEERYFMLF
PNVIIMLSASPRMSGFIYQGRLPLTGTSVTKQPEDAETGHYAFEITGGSIDRTMVFCSSL
QEQQDWLEHLHPYIKNVDVKPLTMPGTSSHHLHGFSTTAVNRGPLEPPKITKPWSLSCLR
PAPPLKPSAALGYKERMSYILKDSSKSPRPIKKFLPKRKTERKPSDDEFLLRKSTAALEE
DAQILKVIEAYCTGASLHQSTTAVRKECVPQVLLPEEEKIIVEDIKSNGQTTIEEKSLVD
AVYALKDEVHELKKENKWMKQCLEEEQKSRKELERVVRKLAKQKNDC
Download sequence
Identical sequences 7955.ENSDARP00000007758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]