SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000011858 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000011858
Domain Number 1 Region: 1-42
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000128
Family Calponin-homology domain, CH-domain 0.0015
Further Details:      
 
Domain Number 2 Region: 170-198
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000761
Family LIM domain 0.018
Further Details:      
 
Weak hits

Sequence:  7955.ENSDARP00000011858
Domain Number - Region: 199-228
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00656
Family LIM domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000011858
Sequence length 496
Comment (Danio rerio)
Sequence
AFRVAEDHLGIPALLDAEDMVALPVPDRLSILTYVSQYYNYFHGRSPIGGVGGIKRHAED
SKEVPSEKKNLPVVAKNHNLKTNTENRPPQSEMPKIINRPPSLNIQKSAPEKHALATPAR
QTGTDRQKSPGPKCVQAPVTPLRARSPQPHREAEKKSVLVETSNKTGTLNSECAVCGNHV
HLVQRHLVDGKLYHRSCYKCSVCYGTLKSGAYKLGSDTGSLVCTIHQHGQNGFKPTVKPF
KSSGFTVSDLVAKSEREDQSPSQRYISVLSAPIKAVPRPVELSLAQQSWTSSAQRTQAAR
QKFFQSCAPATELQPNTKPPLGPAEPSNLKVQEKEGNRALANGNPLHEGNANNNNALNSD
PRAKSQVKISCSSAEVSTWRQELHVRDSKGRSSYQAAPSSPAIISSGGGMNGKESLYLSA
ISKESSRPPSLLQTTAKASANDVQSYDAPADWRSKPKAAPNGPRLNRRMPPASPIVCRVH
PLALSPILNSPNECCA
Download sequence
Identical sequences 7955.ENSDARP00000011858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]