SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000016050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000016050
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.19e-50
Family Calponin-homology domain, CH-domain 0.000000414
Further Details:      
 
Domain Number 2 Region: 183-245
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 9.29e-23
Family EB1 dimerisation domain-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000016050
Sequence length 262
Comment (Danio rerio)
Sequence
MAVNVYSTSMTIENLSRHDMLAWVNDSLQLTYTKIEQLCSGVAYCQFMDMLFPGCILLKK
VKFQAKLEHEYIHNFKVLQAAFKRMNVDKIIPVEKLVKGKFQDNFEFVQWFKKFFDANYD
GKEYDPQLARQGQDVTPPPNPGPQRTSPTAPKTMPTPQRAISSTPSTGIRRNTPISRNGG
DAEIMELNQQLMDLKLTVDGLEKERDFYFSKLRDIELICQEHESDSNPVLGKIIDILYAT
EDGFAPPEDEEIDEQPQDQEEY
Download sequence
Identical sequences Q6GMJ3
7955.ENSDARP00000016050 7955.ENSDARP00000042693 ENSDARP00000016050 ENSDARP00000042693 ENSDARP00000118388 ENSDARP00000016050 ENSDARP00000042693 NP_001002170.1.45394 XP_021330666.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]