SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000017870 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000017870
Domain Number 1 Region: 42-151
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.45e-32
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 
Weak hits

Sequence:  7955.ENSDARP00000017870
Domain Number - Region: 169-256
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00828
Family Spectrin repeat 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000017870
Sequence length 291
Comment (Danio rerio)
Sequence
IKELASTLSFGSRSSSLDSLSSLDSFSGSPASSPVPRGASPLHTRFRLSAKKALLLWVRD
QCQKVGCPASVRDFKSSWRSGEVFLAILCSLRPDLVDLSQFQTSSNQQNLEKAFYLAEKE
LGIPRLLEPEDVDVSNPDEKSIMTYIAQFLQYSNDLPLSDDDIEASPSQKAREMKCWLQR
AYQELLDSWISTEGKGYAERYQAFQNFVGTYYEQRRPVIPVLSAMKRSTKPNEEQMELRK
AWDAMEERLQEYKSELDVGLPAPLNTLGQWLQHIEAVLTEDSSNTEDHALA
Download sequence
Identical sequences ENSDARP00000121145 7955.ENSDARP00000017870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]