SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000022617 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000022617
Domain Number 1 Region: 89-183
Classification Level Classification E-value
Superfamily PDZ domain-like 1.01e-29
Family PDZ domain 0.01
Further Details:      
 
Domain Number 2 Region: 9-65
Classification Level Classification E-value
Superfamily L27 domain 1.68e-22
Family L27 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000022617
Sequence length 218
Comment (Danio rerio)
Sequence
MATVTVQPLTLERDVTRAIELLEKLQESGDVPGHKLQSLKKVLQSEFCTAIREVYQYMHE
TITVNGCPEYQARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYI
SRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLE
EMEARFEKLRTARRRQQQQILMQQQQQQNLAAQQNHMS
Download sequence
Identical sequences Q6PC63
ENSDARP00000022617 ENSDARP00000022617 7955.ENSDARP00000022617 NP_957003.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]