SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000040626 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000040626
Domain Number 1 Region: 14-283
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.02e-90
Family Calponin-homology domain, CH-domain 0.00000428
Further Details:      
 
Domain Number 2 Region: 302-423
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-33
Family Spectrin repeat 0.0000678
Further Details:      
 
Domain Number 3 Region: 609-748
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-31
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 4 Region: 2194-2310
Classification Level Classification E-value
Superfamily PH domain-like 1.93e-29
Family Pleckstrin-homology domain (PH domain) 0.0000531
Further Details:      
 
Domain Number 5 Region: 1016-1174
Classification Level Classification E-value
Superfamily Spectrin repeat 2.19e-29
Family Spectrin repeat 0.0000205
Further Details:      
 
Domain Number 6 Region: 1882-2023
Classification Level Classification E-value
Superfamily Spectrin repeat 9.32e-27
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 7 Region: 1658-1811
Classification Level Classification E-value
Superfamily Spectrin repeat 3.07e-26
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 8 Region: 1457-1598
Classification Level Classification E-value
Superfamily Spectrin repeat 5.16e-25
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 9 Region: 1237-1383
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-23
Family Spectrin repeat 0.00048
Further Details:      
 
Domain Number 10 Region: 823-957
Classification Level Classification E-value
Superfamily Spectrin repeat 5.88e-22
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 11 Region: 432-534
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-22
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 12 Region: 536-643
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-20
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 13 Region: 752-853
Classification Level Classification E-value
Superfamily Spectrin repeat 5.12e-19
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 14 Region: 2029-2109
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000624
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 15 Region: 1814-1918
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000432
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 16 Region: 1391-1493
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000768
Family Spectrin repeat 0.0013
Further Details:      
 
Weak hits

Sequence:  7955.ENSDARP00000040626
Domain Number - Region: 1178-1262
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00187
Family Spectrin repeat 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000040626
Sequence length 2356
Comment (Danio rerio)
Sequence
MATMTSTTDYDNAEITQQYSRINTRFELSDEELDNDNSSARLFERSRIKALADEREAVQK
KTFTKWVNSILARVSCRISDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVD
KALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDIIVETGQADQTGRQET
RSAKDALLLWCQMKTAGYPNINITNFTTSWKDGMAFNALIHKHRPDLVDYGNLKRSNPTH
NLQQAFNVAEKKLGVTKLLDPEVFTENPDEKSIITYVVAFYHYFSKMKALAVEGKRIGKV
LDQAIETEKMIEKYETLSSDLLTWIEQTIVVLNNRKLANSLTGVQQQLQAFNSYRTVEKP
PKFQEKGNLEVLLFTIQSRMRANNQKVYTPKEGALVSDINKAWERLEKAEYDRERVLRDE
LIRQEKLEQMARRFDRKAAMRETWLMENQRLVSQDNFGYDLPAVEAAKKKHDAIETDIAA
YEERVQALVALSKELESERYHDAKRIDARKDNILRLWDYLQELLKARRGRLDKNLTLQRI
FQEMLHIISWMDEMKGRLLSPDFGKHLLEVEDLLQKHSLVEADIAVQAERVKSANAAALK
FANGDSYKPCDPQVIRDRVQHLDLCYQELCALAAQRKARLEQSRRLWNFLWEIAELESWI
REREQIFSSLDYGKDLTSVLILQSKHSVFEDELAARRDNLKQVMDEGESMIQIKHLGSPK
VQQRMNDVQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLVDAMRQMSSDDVGH
DEYTTQRLLKKHRDLRDEAAKNGATIDALSKQANALPEELRNTPDIQGRLNDIRDMYIEL
LTLSDLRQKKLDDTMALYTIFSETDACELWMGQKETWLVGLETPENLEDLEIVQNRLSIL
AQEMGNMQTRVDNVNKAAKQLEDSRHPQTKQVKDCQIRLNKRWEAFKAMVEDKKHRVDSA
LSLHNYDLDCDETESWIKEKTRVIESTQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDS
LRDEAQKLVKEHPENASDILARQEELDAAWDTLKRTLKDREDSLGEVSKLQTFLQDMDDF
QAWLFKSQKAVASEDMPDGLPEAEQLLNLHDALRHDMDGHEEDYHRVKDTGAAVIQGQED
DPQYQQLEQRLEGLDKGWGELHKMWDSRKNFLDQGLGFQQFMRDAKQADAILNNQEYTLA
HVDKPDTLDGAEKALKKHEDFVTTMDANKEKILSTLETGQRLVDSENLYSGKVKDKMSSI
EERNKKNQDKAKEVSGKLKDNRELQHFLQNTQDLTLWINEKMLTAQDTSYDEARNLHSKW
QKHQAFMAELASNKDWLHNIDKEGQELMESKPEFEPIVKDRLAKLHELWDKLESTTQEKA
RLLFDANRSELFDQSLADLKKWLAELQQQLQGDVEEEVKDLTSANILLKKHQITENQVRD
RARELEELQEAVEQHGSLREDQPELEIEQQNLQRDFQKLLTPLSQRKGKLEAAKAVHQFF
RDLADEILWVNERLPMAMSDDHGNNLQTVQLLLKKNQSLQKEIDGHQPRIDEVLERGRRM
AAAAEGSPEEERMSEEMKKLQVVWAQLQEEMAKRRERLYGSNEAQQYYNDADDSEAWIGE
QELYMIADEMAKDEQSAMIMLKRHLVLKQTVDDYAYSIQQLADRAQKMLAEEHPDGEAII
RRQGQVDKQYAGLKELAEDRKKKLDHTYHHFLLSREVEDLEQWIAERDVVASSQEMGQDL
DHVTILRDKFREFARETGTVGQERVDTVNRIIDELIEGGHSESATLAEWKDGVNESWADL
LELIDTRAQLLTSSYDLLKYFYDGKELVGHIEEKKNELPEDLGEDFSKAESFHRMHAAFE
RDISSLGKQARAHQIKNARLHAQYAGDQATAIQATEKEVVEAWKGLLDACAGRRKQLEET
ADKFRFFTMVRDLMAWMESILQQIETQEKPRDVSSVELLMKYHQGIRAEIETRGPKFNQC
VQLGQALLERKHKDSAEIKEKLMQLVEKRKEMMLKWDDRWDWLRLLLEVCQFARDASVAE
AWLIAQEPYVASKDVGQTVDEVEKLLKRHEAFEKSTATWEERFSALERLTTLELLEIRKQ
QQEIQQYRQEAEKESRREDTGFAEESSQLYPTEEQSLSGLGVIEPSSGGVDGTAGESTVP
LISEMQESVSLELDPSTSIQVTKETEKAASLPTESTQVQPVLMEGTLARKHELEGPNKKA
PNRSWNNLYCVLKPGHLSIYKDAKSFSHSVTFHGEEPLTLTNSSCEILTNYKKKKQVFKL
RLGDGSEYLFQCKDEEELQNWTQAIEQAAQVQIEEPVAGPSGVKALSLPPPSSTTLEVPS
TKKDKEKRFSLFAKKK
Download sequence
Identical sequences 7955.ENSDARP00000040626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]