SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000041050 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000041050
Domain Number 1 Region: 89-146
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000000000222
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000041050
Sequence length 158
Comment (Danio rerio)
Sequence
FLPPPPDDFVNSMPPPHPSQSNFPSRNISSGYAPPPPPISSKPSGGGPPPPPPPPAAPPP
PPAAPPPMNFGSSPSSAAAPPASSGEEGGRGALLAQIQTGMKLKKVTASQEPPSPAQDSG
EGIVGALMMVMQKRSKVIHSSDEDDEFDDEDDDDEEWD
Download sequence
Identical sequences 7955.ENSDARP00000041050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]