SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000045010 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000045010
Domain Number 1 Region: 44-111
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 2.09e-16
Family F1F0 ATP synthase subunit C 0.0058
Further Details:      
 
Domain Number 2 Region: 131-200
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 7.98e-16
Family F1F0 ATP synthase subunit C 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000045010
Sequence length 205
Comment (Danio rerio)
Sequence
MNGHAILYTGVTLAFWSTMVIVGICYTIFDLGFRFDVAWFLTETSPFMWANLGIGLAISL
SVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNLAENFSG
TTPETIGSKNYQAGYSMFGAGLTVGFSNLFCGICVGIVGSGAALADAQNANLFVRILIVE
IFGSAIGLFGVIVAILQTSKVKMGN
Download sequence
Identical sequences Q6PD81
7955.ENSDARP00000045010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]