SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000047142 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000047142
Domain Number 1 Region: 924-1034
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-32
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Domain Number 2 Region: 666-752
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000034
Family Myosin rod fragments 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000047142
Sequence length 1035
Comment (Danio rerio)
Sequence
MLKGGTAKVALPRMGAPERAKLSTISSQSTYSGNIGMKTSRSSSTIASDLRLSKIKRASS
DDALAKPVLGSVSRIKKTITTGAIAELTDNRPRSASSVQSTKKSGIPAPREIPQSISRER
LSSRDQQKSSTAKKMVTSSSASSISALAKHSRGSVKTKAESAALDKTLLESQVRELLAEA
KTKEFEISKLRTELQRHKGKDSPSEAGTPEGNSEMERTPALTGDVQVLVGELREKNGRFQ
RELATLREENQSLKQKLIALESASSSKHSVNGVVPDNINGSGLKTSVSSASDIKVSPLPS
LDSSEFEKIPSRSDSVSSSIKSVVPSGVVKDLSVESLTERIQKMEESHHSTAEELQATLQ
ELADQQQVVQELTAENERLAEEKGLLQTSLQQQRERVELLAQQNETLLQRLREQAQSQEA
EASRASRMAELEQRLAEQVESSRFEREKLVDIQQQLTGSLRALEKENQEAQTAVKSLREE
EGLLQGHLESEKLARDEAVRKTEEQRLAMEALRVDNASMKAQVEVERQKVAELKAVQSAS
DNTELQSLLKVAHEDRDKLEMTCTELRQELQQVEADRQQLLEKVEKQEQDHKANTNSLEE
KSIDAENQIKDLKETIFELEDQVEQQRAVRLHTNQTILDLESMIIICLSLAVRIQHCQMI
MIPAAYQIKKLEDNKTELEKQIKVVNKQMKDETEEWRRFQADLQTAVVVANDIKVEAQQE
LRTLRRRLQEEQEHSARLASELEQIQGTRSWNEDASLSDSDGSPHWSRMTISQNAPVGFL
TNGNGSGSSVSSEPEATVKSLIKSFDTATPNGSSSSVQIHTSPRSPLSGIPVRTAPAAAV
SPIQRHSGIKPLSKTLERRIAFGDFPHNGSCDELKPSTLMRKSPSLESVIKTPAHFNGRT
ASFTYNRANSKLSVERTDPLSALAREYGGSKRNALLKWCQKKTEGYPNIDVTNFSSSWSD
GLAFCALLHTYLPAHIPYQELISQDKGRNLTLAFQAAESIGIKPSLDFEELMRTDRPDWQ
SVMQYVSQIYKYFET
Download sequence
Identical sequences A2ASQ4
7955.ENSDARP00000047142 ENSDARP00000120977 ENSDARP00000120977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]