SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000054273 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000054273
Domain Number 1 Region: 63-295
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-87
Family Calponin-homology domain, CH-domain 0.00000102
Further Details:      
 
Domain Number 2 Region: 311-427
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-25
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 3 Region: 1226-1357,1384-1410
Classification Level Classification E-value
Superfamily Spectrin repeat 9.9e-18
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 4 Region: 649-789
Classification Level Classification E-value
Superfamily Spectrin repeat 2.58e-17
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 767-870
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000175
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  7955.ENSDARP00000054273
Domain Number - Region: 1378-1528
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000183
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number - Region: 597-640
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00504
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number - Region: 1022-1161
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00749
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000054273
Sequence length 1586
Comment (Danio rerio)
Sequence
MSSSDEESLSERSCVSERSFRSERSGGSLSPCAHSTAGPKGDTLPWNLSKHERRKRKSQD
SVLDPAERAVVRVADERDRVQKKTFTKWVNKHLIKVRKHITDLYEDLRDGHNLISLLEVL
SGVTLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILH
FQISEIYVSGESGDLTAKEKLLIWSQQATEGYPGLRCTNFSSSWSDGRLFNALLHRYRPD
LIDMQVVAQQSNRENLEQAFEIAESLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPK
IPEGGEGIAAHEVDQRWTEYQSGFSSLLQWTRQHTTLMANRSFPHNPVELKALYNEYVHF
KETEIPAKEREKSHIEHLYKLMEAWIEFGRIKLPQGLHPNDLEEEWGKLILEMLEREKAL
RPAVERLELLLQMANKIQNTALDCEEKLTLAKNTLQADMSQLESGQPVRCENELGMYLQD
CEALVRQLHLDLQVLRDEKYYQVEQLAFRVSCLQEELVSLRLQCASVYRKGHFSTGGLLG
EHVGQRGSSGGLATLGAQTLLGAVAAAASLLRRPMSRADLVAMSSSEDEGSLRFIYELLG
WVEETQDLLERAEWGSDLPSVEQHLQDHHIIHTAVEDLLNSLKEARTYESRVSPNLRSSY
SETLSKLENQYCKLLEHSSWRLRCLESLRAFVSHCTEELIWLNEREEEELAFDWSDSNTN
MAAKREQYADMRSELEEKQDVMRSLQDTADHLCLENHPAKQTVEAYSAALQTQWQWIKEL
CVCVEQHLKDNTAYFQFMSDSRDCESYLRQLQDTIKRQYTCDKNSRLGRLEDLLQDSMEE
KEQLIEYRSTVASLVGRAKSVVQLRPRSADSNLGTTTPIRAICDYRQIEITISKGEECVL
EDNSQRTKWKVISPTGNEAMVPSVCFTVPPPNQEAIDTASRMEQMYQNVMSLWHQLHLNM
KSVVSWHYLQKDIRNISSWSLDTMRLQPPAERQQALDNLDAHLTDFLSDSHESSLFTPTE
RRELEREAENCREHCQTLLVSLETVEKDELASRAYLSELQSIKSHLEDAESRLMRGIQTP
HPSTLSGDAADSAVHIAEQEKLQQDLKGLQSDLGEVSRRCVSFFEEKPTSSSVPVLRSEL
NLAVEHVEKLNSLSSVYLQKLKTVDVLMKSLQAAESQVRKYESRLSEEDIVPADTAAIQA
LGEQLKQWHSELQEQDHIFQSLSLEVQQAREVGNQLSQLHPDRSPELDRYQEKAHQLTDR
WSGVRRQMETRQADLEMLGSVLQQYREGHTSLIRWIEETTEKQENTQPEQTDSRALSEQL
AQQTALVVEIEQNQVKLDECQTCSKQYSAAVKDYELQLMTFRAFVESTQKSPVKRRRMHS
SSDVITQEFMDLRTRYTALVTLTTQHVKYISDALRRLEEEEKEVEEERQARVGQVSDLLG
WVKGLQERTGRSAEPSLVAHQAISEQLAAKKEEVAEAIRSTQVFLMSKQASKLSPEERAQ
VVSQLDELTATYTQLCDSSAAQVQHLEEQLAKEEKRKVELNGQGEVTNDSSVQLSQRQLQ
RLETMLLRYIALNNGHSDDQEMLQQC
Download sequence
Identical sequences 7955.ENSDARP00000054273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]