SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000057380 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000057380
Domain Number 1 Region: 119-619
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.16e-158
Family Calponin-homology domain, CH-domain 0.0000000042
Further Details:      
 
Domain Number 2 Region: 5-99
Classification Level Classification E-value
Superfamily EF-hand 2.65e-16
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000057380
Sequence length 628
Comment (Danio rerio)
Sequence
MENKVTQISREDLEDLREAFNKIDIDNSGYVSDFELQELFREASFHLPGYQIREIVEKFI
AGDTNKDEKISFEEFVAISQELRSKEVRETFRKCISRRDGIRSFGGTSGISSEGTQHSYS
DEEKVAFVNWVNKALANDPDCKHLIPMDPGTDSLFKSVKDGILLCKMINLSQPDTIDERV
INKKCTPFTMTENLMLALNSASAIGCTVVNIDAQDMKAGTPHLVLGLLWQIIKIGLFADI
EISRNEALIALLDESEELDHLMSMSPEDLLLRWVNYHLKAAGWKQIRNFSEDIKDSRAYF
HLLNQISPKGDLDDQMRIDIDMLGLTERDDEMRAELMLRQAARLDCRQFVTPKDVVAGNH
KLNMAFVANLFNMYPALNRPTDNGIDYAIEGETREDRTFRNWMNSLGVSPYVNHLYSDLH
DGLIILQLYERIQIPVDWPRVNKPPYPVLGSNMKKLENCNYAVALGKKEAKFSLVGIGGE
NINEGSPMHTLALVWQLMRRYTLKVLSDLGDGEKVSDQIIINWVNSTLKQGDKNSSISSF
KDKSISTSLPVIDLIDTIVPKAIKYEMVKSGDMTAEDKLNNAKYAISVARKIGVKVYALP
DDLVEVKPKMVMTVFACLMGRGLKKVDG
Download sequence
Identical sequences A5PM88
7955.ENSDARP00000057380 XP_021334718.1.45394 ENSDARP00000057380 ENSDARP00000113948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]