SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000058483 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000058483
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.86e-50
Family Calponin-homology domain, CH-domain 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000058483
Sequence length 331
Comment (Danio rerio)
Sequence
MTQFNKGPAYGLSAEVRSKIAQKYDVQKEEELRYWIEDVTGMPIGENFQMGLKDGVILCE
LINKLQPGSIKKINHSKLNWHKLENLGNFIKAILAYGLKPNDIFEANDLFENGNLTQVQT
TLLALASMAKTKGMNTKVDIGVKYADKQTRSFDDEKMKAGQCVIGLQMGTNKCASQAGMT
AYGTRRHLYDPKTQADKPFDQTTISLQMGTNKGASQAGMSAPGTRRDIFDQKVAVQPLDN
STISLQMGTNKVASQKGMSVYGLGRQVYDPKYCSSPTEPTIHSNGSQGTGTNGSEISDSD
YQAEYHGEYQDEYQADYHDEYRGQYDHGIDY
Download sequence
Identical sequences Q32PU2
7955.ENSDARP00000058483 ENSDARP00000058483 NP_001019244.1.45394 ENSDARP00000058483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]