SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000064113 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000064113
Domain Number 1 Region: 12-143,188-293
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-70
Family Calponin-homology domain, CH-domain 0.0000774
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000064113
Sequence length 687
Comment (Danio rerio)
Sequence
MTSRLSERNGQVGKEKKCKQRAQDERHAVQERTFTKWINMHLKSCEPPLQVHHLFTDIQD
GKVLMALLEELSGCNLLDKFRPFPHRIFRLNNISKVLNFLKDRNISLVNIEADDIADGSP
SAVLRLIWNIIVYYQIKQVTRSLEKSPSTFSLLSLPCDSDSSGRSSPASPGDDIFGTLPS
KGKKSLKNLKYRGTAIKTLLSWAQNCTAKYGVEIRDFGKSWRSGLAFVALVKFFCPEFVH
MRKALSSEPRLNMETAFRAAQEWLGIPPLLNPDDVAVHSPDEQSIITYIAQFLECCPGHD
EDAMSTDSSRGTPNSTERWDRVSTDSDSCVFPSNVSTEALRDLYNLSETSEEEQTYHTGD
QESLSVCQENIRDLAARSESLLNVKKTSTGGQCCDSIAWRKRWIGSLEDDGNCSEVSKEA
VYSLSVLDSDEEDAFSYILELDHKDSGLESNIDFGLNTVMDSQAVEFDLNVASIFETQES
EIKYCCCEAQRNLKATDVSVRSGGGKCTNKITLDQVRPTKSNILTENNCDEKTLPASDTL
LMNQNSIEKIENNFKLYTDERPDLNCSLKMKESDSADAFTHSNGTDDAFVHLDNCVDEDK
LREELFLCPVKENLLDNDQYEQNNVLDRSVLDGITEEPAVSHAKRKEGLDQASYEVQELH
MLLFLWMIAYCVLMYPHLDIFSLLSPN
Download sequence
Identical sequences F1RA97
ENSDARP00000064113 ENSDARP00000064113 7955.ENSDARP00000064113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]