SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000074994 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000074994
Domain Number 1 Region: 1156-1442
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 8.03e-42
Family C5 cytosine-specific DNA methylase, DCM 0.0051
Further Details:      
 
Domain Number 2 Region: 7-124
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-29
Family Calponin-homology domain, CH-domain 0.00018
Further Details:      
 
Domain Number 3 Region: 783-913
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.42e-20
Family PWWP domain 0.00025
Further Details:      
 
Weak hits

Sequence:  7955.ENSDARP00000074994
Domain Number - Region: 1060-1132
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000623
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000074994
Sequence length 1448
Comment (Danio rerio)
Sequence
MVADVKIGDDKQSLCELLDWLNGLLQATFSQVEDTCSGAAFCQLMDIIQPGSIDVTKVNF
TAEENLDILNNYNLLQEAFSKAQIQKELELTLLVNGDIMTTCDLLTWFKDMYDHNFAKQK
CNPQVAFIKPEVVSLKSSREFETIEKENVSSLYNTEETSSNQKTQHVEKTSQESVSWSPL
TSFIRKYGSSTLTDDESNNVNSKDCPGQKSFGDITPFWRQTPYCLYLLHGVELEDDKKAS
VLLLGFFDKETGENKIRLLDVVYPTKESTEDICNYILDTLRKIGIPLFNMAILYSDFPDH
EHLVAGLQLMKAEIVSLCGLTDLTGQVCHSGVEKIEFSDLILNLITEIYKHFPSFPADLQ
ALLEDVVGSDIDNLTSQCSLFWRIIKKIPLAWSHLENYFGSLGTEEEAVCLLLEDPKIKL
NVLFLTHALQPLCDFQEIIDQGASVLQLLQDASKLLRLYTQSFLRPKAAEYFHRRGKTSL
VQETVGHLPRGEVAVGEQAADFLQQHSEELSDYLETFHSSIISFYTTVTVNIVKRLPLPD
STLRNLSLVLSPGKKLEVTGKMVQDLGVGFGVCIRPDNVSLLTDEFLEYQLIDGGDTGSV
DQPTEKYWQTELRIMGNASNFGKLIVSLLALPKTLKKEIIFKQMFQQTDYLKMMRKEDCE
EKDMMEDDVTDSSSYKSAPSHLSPETQGSSISDVIDLTEMDEIGPVEIEDIAPMDVDDIV
SISSDSETENQKVNVPHVSIVLDDDDDDDDEMTDDDDDYGCEAGEVMWKYSKNKGNTQNE
MTDNTYQGGFSVGEMVLGPIEGFGLWPGLVQSWDSERPCGSMRKVIFFGNGMQTEVQADS
LLPFSSLAKCFCSNSFATVMAYKDAIFSSLQVASRRSRMFFSPESESKDELLRVMLNWAF
GGFEPLGADGLQPQAEYSVKVKKGKRKNPTGKLFNLTVPLNKIPESLDLNNGSVDLGTTD
ADKKRLYSKWNGRSMQTVKIRRKYKQRNKNIIPTVQIESRQNSQKRHQMVHEFLKNKRKI
EDFCLSCGSMSVDIIHPLFEGKLCTNCKFNFTETLYRYDEDGYQSYCTVCCSGMEVILCG
HDSCCRSFCVDCLDILVCQGTFDQLKNVDPWTCYLCAPETSSGALKPRHDWSIRVQEFFA
NDTGMEFEPHRVYPSIPAIQRRPIRVLSLFDGIATGYLVLRDLGFKVEKYVASEIDEESI
TISMVNHDGKITQVDDVKNITKKHIEQWGPFDLLIGGSPCNDLSIVNPARKGLYEGTGRL
FFEYYRLLNVLKPKEDDPQPFFWLFENVTFMQTHVKADICRFLECNPVLVDAVKVSPAHR
ARYFWGNIPGMNRPIIASQNDKLCLQECLEPGRTAKYEKVRTITTRQNSLKQGTNDAHFP
VTMNGKDDHIWITELEKIFGFPKHYTDVKSMGRPQRQRVLGKSWSVPVIRHLLAPLKDYF
ACDEFPVK
Download sequence
Identical sequences A3QJV0
ENSDARP00000074994 ENSDARP00000110904 7955.ENSDARP00000074994 ENSDARP00000074994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]