SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000077048 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000077048
Domain Number 1 Region: 77-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.24e-32
Family Calponin-homology domain, CH-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000077048
Sequence length 197
Comment (Danio rerio)
Sequence
MENLRQGTGGKTSASLSKDQKASNGPGGAQFNAHRTAQAKTLSQPTSVSSPKTVSSPAQS
HVARVKMSGGSAVGGPNTKDVKQMLLDWCRVKTEPYEGVNIQNFSSSWADGLAFCALVHR
FFPEGFEYCTLNPYDRKSNFEKAFKTAERLADCPPLLDVDDLMRMREPDWKCVYTYIQEF
YRCLVEKGLVKTKKKMP
Download sequence
Identical sequences E9QIL4
ENSDARP00000117082 7955.ENSDARP00000077048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]