SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000077049 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000077049
Domain Number 1 Region: 7-123
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.02e-37
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000077049
Sequence length 137
Comment (Danio rerio)
Sequence
AIAQVNRVQRSTSFGVPNANSIKQMLLDWCRSKTRSYENVDIQNFSSSWSDGMAFCALVH
NFFPEAFDYSSLSPTNRRQNFETAFSTAERLADCPQLLDVEDMVRMREPDWKCVYTYLQE
FYRGLVQKGLVKTKNSS
Download sequence
Identical sequences ENSDARP00000077049 7955.ENSDARP00000077049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]