SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000077150 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000077150
Domain Number 1 Region: 1056-1195
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.33e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000887
Further Details:      
 
Domain Number 2 Region: 11-114
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000181
Family Calponin-homology domain, CH-domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000077150
Sequence length 1200
Comment (Danio rerio)
Sequence
IRYRKDRMQSKLKPCFPVVNEVKDLSNGCAIAAVIHYYCPSLLRLEDACMKDSMTVADSL
YNLQLIREFCDSCLKSCCPLVLEDLLYSPSELKTNILSFLAELLYWFEVSKPEFVQPLQD
SVTETSGKINNGNSGSSNGGSPSIFKKPFLPISSPVTVATEAAGRSWSKKPLSRPLSAVS
FSIPFGLDSDVDIVMGNPVITRSVSSDNLNPGGQSMTRVPYTPPEDLSHLLSKAPGPNGP
QRASWGIRTRPMLAEENGIEESETGELPTIEEALQIIHNEEKMEPRLHPEGAPDGFYLHS
PDDPANARLNGSPVTLSSSAPSRSGMLYHRTPGVPPEPSRTRHPSEGSRDDDSVLRDGSV
DSDASEDLPKTHSTPVTPASGPRITQPRGEETPDSGVKMTNFAERKKKLVPEQVRPSEPE
APQMTTWAKKSEESPSKSPALSTEMSELGARLEEKRKAIEAQKKRIEAIFAKHRQRLGKS
AFLQLKKEQEDGDGEEGHHGGGSATSVEDDLSRLALEEKLARLEREEQQEEQQEEQLNKG
PLVEEAGNVKPSVKQDKHGEKQKPEVETPGGKGTAPLGEYNNAVSKLSAALSSLQNDMQR
LSEQQNQLMKKKATPTKQAWVIPPSSKPSTTTPRLSRESTRELSSATSSPSPSRKISGHT
GPPKSPGAHRRAQSAPPKSPKVHHHPRPAELKTPISTRVITPPQSVDNIPHLRRVSPWQC
RDQNSSSFSIGTPSQSESRSASSLARPEDNFSDTGSSEDQTIFSMDLDGGSSQVLPRKER
QGGGSSSGAPSECSFESDIPVAALNGKRGSLIEISLSSLKALDGEEADQSQDIFSDSMSD
QTEPETRGGVGFFFKQDEARPEDEMEKRRAALLEKQQKRAEEMKRRKQEQEREREASRSS
SVDEPRRGEERPQTPSTPPPPRTPPPEGTPQRRGDFTRQEYERRHQLKIMEDLDKVLRQK
PTTVRGVKKQRPKTVFRDDSDLSRSPAKGFMGSRLNKVYSHSTMNLSSMANDSGTLTVRK
SPSRSHSPSRLLSPGRLAAQNGDWDNASTISSPASIPEYTGPKLYKEPSFKSNKFIIHNA
ISRCCLAGKVNEPQKNKIVEEMEKSAANHFLILFRDASCQFRAVYTMNPETEEMVRLVGI
GPRVISPIMVESIYKYSSDRKQFTAIPSKTMSMSVDAFTIPSHLWERKRPGTPKKLGTPK
Download sequence
Identical sequences 7955.ENSDARP00000077150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]