SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000089393 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000089393
Domain Number 1 Region: 32-254
Classification Level Classification E-value
Superfamily L domain-like 4.9e-45
Family Ngr ectodomain-like 0.053
Further Details:      
 
Domain Number 2 Region: 529-633
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.94e-25
Family Calponin-homology domain, CH-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000089393
Sequence length 681
Comment (Danio rerio)
Sequence
CLMAAGDGAQLPATVAASRSVEKALEEAASSGALILSNRKLKEFPRTARNYDLSDITHAD
LSKNRLCEVPEEVCQFVSLETLSLYHNCVRSLTLSLCQLQALTYLNLSRNQLSSLPPSVC
QLPLLRVLIVSNNKLSALPASIHTLTHLRQLDVSCNELPSLPVELGQLEGLRDLNLRRNQ
LTTLPEELSELPLVRLDVSCNRISHVPVCYRHLRHLQSIILDNNPLQMPPAQICSKGKFH
IFKYLNMEACKITQDQYEKALRPTGFSSCLDQDLFPVQFGGLDSGFNSVDSGSKRWSGNE
SADDFSERSLRLTDVSREHTHFQEEEERETLLDAPKVNGEVEQVDFIDNSLVEEEEERIF
VIGDGSDSGSPSSPTLEEKRRPGNLLIWQERERAQQQRDRASTLQKITVKTGSSSAAVTT
TAKHGGTGSFSGGDSDSSSPPNGLKQRCASADQVSPSSHTVSLQRSVSRTDASSVKPCSP
TGSAPKPNSFLFRTSSRCNVKTGSGNSLAESGRSESRSTLRSPREERTDIMQLRKTLESR
LKISLPDDLGEALSNGTVLCQLANHVRPRSVSIIHIPSPAVPKLSAAKCRLNVENFIAAC
RRLGVPEMELCLASDILRSKLPAVLRCVMGLLAKAGDEEVTEDKNTTSPFVSPSSPFSIG
FLLFYSLLMALLYLLYCNLIA
Download sequence
Identical sequences A3QJZ8
7955.ENSDARP00000089393 ENSDARP00000117688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]