SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000090990 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000090990
Domain Number 1 Region: 30-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.73e-85
Family Calponin-homology domain, CH-domain 0.0000186
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily Spectrin repeat 2.7e-33
Family Spectrin repeat 0.000000549
Further Details:      
 
Domain Number 3 Region: 513-634
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-31
Family Spectrin repeat 0.00000311
Further Details:      
 
Domain Number 4 Region: 400-510
Classification Level Classification E-value
Superfamily Spectrin repeat 9.29e-25
Family Spectrin repeat 0.00000399
Further Details:      
 
Domain Number 5 Region: 637-749
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-23
Family Spectrin repeat 0.00000241
Further Details:      
 
Domain Number 6 Region: 748-873
Classification Level Classification E-value
Superfamily EF-hand 3.29e-20
Family Calmodulin-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000090990
Sequence length 902
Comment (Danio rerio)
Sequence
MDHHHHPQHHHHHQYDGGENDYMQQEDDWDRDMLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALGFIASKGVKLVSI
GAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFH
ISWKDGLGFCALIHRHRPELIDYNKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGT
ARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWI
RRTIPWLENRVPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNR
PAFMPSEGKMVSDISNSWGRLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWT
DGKEEMLQHKDFETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSP
SVNARCQRICDQWDSLGVLTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAME
DLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGQN
PYTTINPQEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKM
EEIGRISIEMHGTLEDQLTHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTM
EHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGAEE
FKACLISLGFDIGNDAQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVM
ASFKVLAGDKNYILADELRRELPPDQAEYCIARMTPYSGPDSVPGALDYMSFSTALYGES
DL
Download sequence
Identical sequences B8JHU4
NP_001161758.1.45394 ENSDARP00000090990 ENSDARP00000120755 ENSDARP00000123299 7955.ENSDARP00000090990 ENSDARP00000090990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]