SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000101015 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  7955.ENSDARP00000101015
Domain Number - Region: 162-304
Classification Level Classification E-value
Superfamily Tropomyosin 0.00301
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number - Region: 5-51
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0267
Family Calponin-homology domain, CH-domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000101015
Sequence length 427
Comment (Danio rerio)
Sequence
MSFRDLRNFTEMMRALGYPRLISMENFRSPNFPLVAEILIWLVKRYEPQMEIPSDVDTES
DRVFFIKAVAQFMATKAHVKLNLKRLYQADGYAVKEMLKITSILYNAMKTKENAGGDQNN
DENSKFKFDLGSKIADLKLARQLGSEITAKGAALFDLLGQEEDLRESRTAAIARPLEITE
TERAIRAAVKDVTESIQMTKDLLNNVSSDEASLEAKIEKKKQDLERNQKRLQTLQSVRPA
FMDEYEKIEEDLEKQYQTYVEKYRNLSFLEQQLDDYHRVEQERFEEAEMAMKMRQNKLKE
EEKRLMRSGVARDEDSDVDIPEDEGSDSDIDDGQQARPHHPRHTQISGRGGARFIGSMRG
GDSEETEDSEIDVDDDDEDDDEDGEEDEEENEDLDEDNDSLEGSSGKPGRTNQSLHPQIL
EESDNDF
Download sequence
Identical sequences F1RA40
ENSDARP00000101015 7955.ENSDARP00000091300 7955.ENSDARP00000101015 ENSDARP00000101015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]