SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7955.ENSDARP00000102414 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7955.ENSDARP00000102414
Domain Number 1 Region: 1891-2065
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000416
Family Extended AAA-ATPase domain 0.067
Further Details:      
 
Domain Number 2 Region: 5-58
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000222
Family Calponin-homology domain, CH-domain 0.0063
Further Details:      
 
Domain Number 3 Region: 1922-1975,2067-2160
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000344
Family Nucleotide and nucleoside kinases 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7955.ENSDARP00000102414
Sequence length 2219
Comment (Danio rerio)
Sequence
SFSLQIENIDACLSFLAAKGVNIQGLSAEEIRNGNLKAILGLFFSLSRYKQQQQTSRQTH
TQHTHSHTHLIQQSSAPAQLISTPHGPHSHKTQTDMQSRRSVMYCSVQPIHPSIIHCQKK
SSRLPGPTSRMSTAGSESSPRGSISSAGNRRSLVFSDKAKPAAAQAKESSESVTDPALSS
ACTSLSTSTVASSSSSSAIPQPNSSSKPWRIKSQNSKHTSATSTGLSTKSDLQAKQPVPA
EAPPKAVPQKSMLEKLKLFNSKGGSKSSTQTEGAVTPTGGKDAALVLERVETGSNTEPIE
EMDGNVRPTNGAVSVTTSSPKIALKGIAQRTFSRALTAKKASAKSSEKEKGKDKNASKRG
SPSEKVEEVNVVTAPSEPEPRKASKIASFIPKGGKVGGAKKDGPAPVQSGIPKPGSKSAG
NGAVKGSALPLGGKDNERPRSVRLGAGLGLHRDSRHSSSSSSLASTEGKGHPMHSAAPVA
NGTQSTASNTVSVQLPQPQQQYNHPNTATVAPFMYRTQNEADGNMGTNLSSGCRSSDSGS
FSKTNQSSTEDLSAGEDPETRRLRTVKNIADLRQNLEETMSSLRGTQITHSTLETTFDGG
VTTEMSSRNILSMASRPSPLSWASRMGQSSPRLQAGDAPSVGNGYQSRSGGVAPGQGRYL
YQAPLRKQLAARGSGLCGLELGDRVEDLELAGVGLEMSAYMSDGDGCGYPSSLNHLDHQY
MTDGGLSLYTRRLNRLPDGMAMVRENLQRNASTSQGDADSWDDSSSVSSGISDAIDTDDI
NTSSSISSYANTPAASRKGLNGQPQTDAEKHSAAERNTSRSIDEVKKSDGGLDCSIKSDS
GLKWRRNPSDVSEESDKSSSGRKTAPVTQTGSWRRGMSAQDPASSRHKGQTRIRTKPLGK
TDDAKVSEKGCMSPSSNILQHSSSDTGRSSGDEAKKTTAGRVPTSTFGFKKPNGVHNPSN
VITTASITLVTASGATITSGSATLGKIPKSSALLVGSRGSLKGAVDGLLPPQEDGYLSPS
ARSTLQYRSLPRPSRSGAAARNGNRSSTSSIESSLLTRAPLLTAITANKPRDPGPKTNGH
AIQANQTDKEKGVASDIDSTRTNPIVSGGGAATIPQTARQGNKYSEVSSPTLRRLFGGKA
AKQAPVTTAESMKNSMVISNPHATLGHTQSSGGPLDSPSTVPGSGGSSPLYGGRGASIGG
SEQASSPGSVYSTGTGTWGTTISSSSALGYPSVSSMHTSSESIDMSVGSGHPRDDVHPAL
MRTGSAKTGMSESPKFNRNTLPRKQDRYAPSQQLRQEEARDWLRSHSAGGLQDSASNSPF
STGSSLTSPSGTRFNFAQLGSPTTGAQINLASLRNNSLTSQDNPLDSHADSRLRNSCMSL
DEKTRTMSRSGSFRDGFEEVHGSSLSLVSSTSSVYSTTEEKSQSESLLQIRKLRRELDAS
QEKVSALTTQLSANAHLVAAFEQSLGNMTIRLKSLTMTAEQKDSELNELRKTIELLKKQN
AVAQAAINGVISNNGSGLGAPPDLRMRRQHSSDSVSSITSATSHSSLGSNMDNPDSSSKK
KKKNWVVSIGYKLRSSFKQAFSKKKSPKSASSHSDIEEMTDSSLPSSPKLPHNGSGSTAL
LRRNTHSSSILQAASAFVYLPQKFLNKVFVFSKICRLSDCLDGEAETVMQLRNELREKEM
KLTDIRLEALSSAHQLDQLREAMNRMQTSRVTSFGNNSHVLSDLKHVILRNRSPHNFNPF
IHFFYHKRATETPKNLILKNNAVCVFSDMLLDDSGGDGSSRKESRHVKIVVSLQEDVMWK
EDCRTRHFLIGCIGVSGKTKWDVLDGVVRRLFKEYIRHVDPVSHLGLGSDSVEGYRIGDV
VRCSGANTPELLPCGYLVGENDTINISLKGVNSQSQDSLVFETLIPKPMLQRYVSLLQEH
RRIILSGPSGTGKSYLAHRLAEHLALQEGKLPSDSNIVTFNVDHKSSKELRQYLANIVEQ
CSAAGQDTEAPLVLILDNLHHISSLGEIFSGLLNCRYQRCPYIIGTMSQATSSAPNLQLH
HNFRRWVLCANHMEPVKGFLGRYLRRKLIETEIGNRTRNPELVKIIDWIPQVWQHLNRFL
EAHSSSDVTIGPRLFLSCPMDVDGSRVWFTDLWNYSIIPYMLEAVREGLQLYGRRAAWED
PALWVLETFPWAASHQHPDWPALLQLRPEDVGFDGYSASREGVSKQSTQSDSDADPLVS
Download sequence
Identical sequences 7955.ENSDARP00000102414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]