SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000002109 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000002109
Domain Number 1 Region: 26-278
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-89
Family Calponin-homology domain, CH-domain 0.00000258
Further Details:      
 
Domain Number 2 Region: 295-415
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-33
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 3 Region: 2348-2467
Classification Level Classification E-value
Superfamily PH domain-like 2.89e-32
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 4 Region: 814-950
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-23
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 599-717
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-22
Family Spectrin repeat 0.00043
Further Details:      
 
Domain Number 6 Region: 1697-1800
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-21
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 7 Region: 1590-1693
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-21
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 8 Region: 424-526
Classification Level Classification E-value
Superfamily Spectrin repeat 4.97e-21
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 9 Region: 1750-1903
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-20
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 10 Region: 1858-2013
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-19
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 11 Region: 1451-1586
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 12 Region: 693-803
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-18
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 13 Region: 1036-1163
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-18
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 14 Region: 1169-1271
Classification Level Classification E-value
Superfamily Spectrin repeat 2.04e-18
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 15 Region: 528-635
Classification Level Classification E-value
Superfamily Spectrin repeat 6.28e-17
Family Spectrin repeat 0.00057
Further Details:      
 
Domain Number 16 Region: 1327-1446
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000357
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 17 Region: 950-1056
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000432
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 18 Region: 2017-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000648
Family Spectrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000002109
Sequence length 2501
Comment (Oryzias latipes)
Sequence
MANASPDLDNAEAQRQLNNNNRPNSSGFWEAECTSSKLFECSRIKALADERDAVQKKTFT
KWVNSHLARVNCRISDLYNDLKDGYMLTRLLEVLSGELLPRPTRGRMRIHCLENVDKALQ
FLKEQRVHLENVGSHDIVDGNHRLTLGLIWTIILRFQIQVIKIATEDNRETRSAKDALLL
WCQMKTAGYSEVNIQNFTTCWRDGLAFNALIHRHRPDLIEFHKLTRSNATHNLQQAFNVA
EQHLGLTKLLDPEDVNTENPDEKSIITYVVSYYHYFSKMKALIVEGKRVGKVLDKCIEAE
KVISRYEALASDLLDWIEKTIAIISNQKFANSLTGVQQQLQAFTTYCTIEKPIKFQEKGN
LEVLLFTIQSKLRANNQKPYVPHEGKLISDINKAWERLEKAEHERGVALRKELIRQEKLE
LLAQRFDHKTTMRQAWLNENQRLVSQDNFGYDLPAVEAAMKKHEAIEADIASYEERIGVV
VELAAEMEVEGYYDIRRILARKENILGQWSLLKELVAGRRARLEQNLALQKTFQDMVYMI
DWMEDAQAQLLSKDFGKHLLEVDDLLQKHSLQEADISVQAERVETLNAAALKFTTMEGYQ
PCDPQIICNRVNHVSSCLEDLKHLAADRRSELEESRQLWAFFQELEESEAWIREKSSILA
SQGFGRDLSSVLKLLQKHKTLAGELLAHRSLLQNTMKRGKQILSEKSFGTTGIQERILEV
KDEWKKLEDQAAQHLSHLQEALTFFQFSTEMDDLVAWLQDAYRLVSSEDFGHDEYSTQSL
LKKHRGVTEAIDKHRLHVVALRKHMGVLPLQYREQEEVQVRMAEVEQLYTEVADVAVLRQ
QWLHDALAVYHMFSEVNACELWIDEREQWLDKMEIPEKLEDVEVVAHRFESLDQEMNSLM
GRILDVNQIVQQLLDGGHPSSAEVRGCQDHLNSRWNSIVELVEQKKDQLDSMLRLQNYLL
ECAEIKSQIQEKKKAIDATQYMGSDLGGVLALQRRLSTMEGALAVLEPKLLHLQEEAEHL
ATAHSGRAMEILVPFDGISVEWEELKQTLQGCEDSLMVASRLQSFIQDLDSFLTWLVQTQ
TAAASDQLPNDLEEAEKLINKHAALKEEIGRYEEDYERLQAMNELLESEDAPLPQAALQQ
WLQKLDVGWNKLLEMWESRREVLVQAHIFHLFLRDVKQAESFLNNQESALAHVELPTTVE
TVEAAIKKHKDFTTTMELNLHRIKAVIEAGESLISQNNIYSDRIRERIDTLAKRGNQNRH
LAQKWLEKLNDQWELQRLLQDCHEISQWLSFTTAASCDGSAEDQHKLHKNSLNHRVYSAV
KIQNVEKMDIPENEGQKLIQEKPELSPVVRRKLEEIRECWQDLESTTQAKARQLFEANKA
DLLVQSYESLHQRLGQLEGQLAYVDQGQDLTTVNKQLKKLQTLEGQMEEWYQEVGQLQAQ
AASIPQQTPVKQTVAERQTAVETRMLRLIEPLKERRRILLASKEVHQVGRDLEDEILWVQ
ERLPLATSQEHGSTLQAVQQLMKKNQSLQRELQSHRSRMEEVLEQAGIIASIRSPAADCI
RAGQDQLAQLWALLWTETERRQLLLDTMYQVQQYYLDTAEVEAWLSEQELHMMNEEKGKD
EPSTLQLLKKHLVLEQTIEDYAETIGLLSQQCRQLLEMGHPESEQISKRQSQIDRLYVSL
KDLVEERKSRLEQQYWLYQLNREVDELEQWIAQREVVASSPELGQDFEHVTVLQEKFTEF
ASETGSVGQERVTAINQMVDELIDYGHSEAATIAEWKDGVNESWADLLELMETRAQMLAA
SHQLHKFFSDCREVLAQIQDKQKRLPEVRARQGSTSNTSTLQRLLHSFEQDIQLLVTQVR
QLQESAAQLRTVYAGEKADAIACCEHEVMHSWKELLTSCEECRLQITTETDKLRFFSMVR
DQIMWMDSILCQIGTGEKPRDVSSVEVLMNDHQSLKSEVEARSQSVLECIEMGKMLLAAR
NPAAEEIKEKLDKVIAKQRELTEKWDKHWEFLKQLLEVHQFAQEAVVAEAWLTAHEPFIN
SKELGESVDEVEQLIRRHEAFRKAAATWEERFSSLRRLTTVEKLKAEQGKLPSTPLLGRK
VFLDPQDALASPSTLPRLPVSPVIRQTIYEQNEANRPEVAVMAEVVLQERGRERLHSEPT
RGSRGSRPDPMGHAEPQAQTHLQQRGHRMERQLSSEQLIQARRDELPQEVWREQAERRDR
RTLERQTSSEHEGHGGHEGRRRERDRHRLDRQDSSEHDTGREQEKRTTMADIVEQLQERE
AAQGIPVLLKENPEARGEVPRLPNGFPEKTSRPDRPRARDRPKPRRRPRPKEPGETTRRS
RSAPAQSSPAVPQPPTHTAHHEGFLFRKLDIESLKKSTNSRSWVNLYCVLNKGELGFYKD
AKNTTTPYNNEPMLSLSHCQCDVTNGYKKKKNVFTLKTKDGSEFLFHAKDEDDLKTWVTN
ITASISEHEEIAKWGQPQPTTSSTDEGTRRDGGSKADNRSE
Download sequence
Identical sequences H2L8D8
ENSORLP00000002109 ENSORLP00000002109 8090.ENSORLP00000002109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]