SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000002512 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000002512
Domain Number 1 Region: 39-277
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-90
Family Calponin-homology domain, CH-domain 0.000000909
Further Details:      
 
Domain Number 2 Region: 2175-2294
Classification Level Classification E-value
Superfamily PH domain-like 7.61e-36
Family Pleckstrin-homology domain (PH domain) 0.00000401
Further Details:      
 
Domain Number 3 Region: 603-742
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-31
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 4 Region: 1644-1799
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-30
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 1010-1166
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-29
Family Spectrin repeat 0.0000268
Further Details:      
 
Domain Number 6 Region: 1223-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 2.23e-27
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 7 Region: 1857-2011
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 8 Region: 816-951
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-26
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 9 Region: 1450-1586
Classification Level Classification E-value
Superfamily Spectrin repeat 5.52e-26
Family Spectrin repeat 0.0004
Further Details:      
 
Domain Number 10 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-24
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 11 Region: 296-416
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-22
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 12 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-21
Family Spectrin repeat 0.00033
Further Details:      
 
Domain Number 13 Region: 746-848
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-21
Family Spectrin repeat 0.00041
Further Details:      
 
Domain Number 14 Region: 1351-1428
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000157
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 15 Region: 2016-2077
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000187
Family Spectrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000002512
Sequence length 2346
Comment (Oryzias latipes)
Sequence
NMTSVAAEFEHMEIQQQYNDGVNNRWDADDWDNENSSARLFERSRIKALADEREAVQKKT
FTKWVNSHLSRVSCRITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKA
LQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDAL
LLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFN
LAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDHAIE
TEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKLTVY
KNSSLLQYFSKNMHSEHQPLPIHERQKVIFSVPKAWERLEKAEHERELALRTELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQA
VVSVAKELEAESYHDIKRITARKDNVNRLWEYLLELLKARRHRLEQNLGLQRVFQEMLYI
MDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRNVNSNAQRFASDTEG
YKPCDPQIIRDRVAHLEFCYQELIQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQI
LSSEDYGKDLTGALRLLSQHKAFEDEMSGRAAHLQQTIKQGEDLVADNHFGADKIRERIR
DIQEQWATLERLTAVRKSRLQEACNHHQFQADADDIDTWMLDVLRIVSSVDVGHDEFSTQ
ALVKKHKDVAEEIDSYRPVIEALHDQSRTLPPEKANSEEVKSRLAGIEERYKEVAELTRL
RKQALQDALALYKMLSEASACELWIDEKEQWLNSMDIPEKLEDLEVVQHRFESLEPEMNS
QASRVAVVNQVARQLIHCGHPSEKEIKAQQDKLNTRWSQFRDLVDQKKESLVSALGVQNY
HLECNETKSWIKEKNKLIESTQELGNDLAGVMALQRKLTGMERDLVAIEDKMGDLGKEAE
RLASEHPEQSEAIKGRLAEITGVWQEMKDGLKNREESLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLAEAEKLLAQHENIKNEIRNYEEDYQKMRDMGEMVTQGQTDAQHMFL
RQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEAAEAAIKKQEDFMTTMDANEEKISNVVDTGRRLVADGNVSSERIQEKVDSIDQRHKKN
RQAASDLLMRLKDNRDLQKFLQDCQELNLWINEKMLTAQDMTYDEARNLHSKWLKHQAFM
AELQSNKEWLDKISKDGQTLMTEKPETEGVVKEKLASLKTMWEELESTTQTKAKCLFDAN
KAELFTQSCADLDKWLNGLEGQLQSDDFGKDLTSVNILLKKQQTFLAQCLPELSSFPLRC
WRARWRCEGKDSDEVDGQRIIVEKKFQTLQEPLKKRRDKLMASREIHQFNRDVEDEILWV
EERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRYDDIFERSQHVLREGSPTAEL
IRQRLAELQSLWEQIKKETEKRHTRLSEAHEAQQYYFDAAEAEAWMSEQELYMMSEEKAK
DEQSAVAMLKKHQILEQAVEDYADTVHQLSSTSRGLVAAGHPDSERIGMRQSQVDKLYAG
LKDLSEERRGKLDERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFRE
FARDTGNIGQERVDGVNRLADELINSGHGDAATIAEWKDGLNEAWADLLELIDTRTQILA
ASYELHKFYHDAKEVLNRILDKHKKLPEELGRDQNTVEALQRMHTAFEHDIQALGTQVRQ
LQDDAVRLQSAYAGDKADDIQKREGEVLEAWKNLLAAVEGRRAKLVDTGDKFRFFSMVRD
LMLWMEDVIRLIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKALLARKH
YASEEIKEKLLQLTDKRKEMIDKWEDRWEWLRLVLEVHQFSRDAGVAEAWLLGQEPYLSS
REIGQSVDEVEKLIKRHEAFEKSAATWEERFSALERLTTMELLEVRRRQEEEERRRQPEA
QTAEGAAQSSSKHSQWSFSRDELLSQNGLPTEQEAPRDNGEGGEVVNGVSEPSPSGSPGA
SRKAKSSQAATLPAKSQQDGPTSQQEGFLHRKHEWEGHNKKASSRSWNNVYCVINQQEMG
FYKDQRSAGQGIPYHSEIPVSLKDAVCEVALDYKKKKHVFKLKISDGNEYLFQAKDDEEM
NLWISTISGAISGDKPEVTPSSHSTPAQAARAQTMPAAVATTTAESSPGKREKDKEKRFS
LFSKKK
Download sequence
Identical sequences H2L9H0
ENSORLP00000002512 8090.ENSORLP00000002512 ENSORLP00000002512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]