SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000002664 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000002664
Domain Number 1 Region: 2-41
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000785
Family Snake venom toxins 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000002664
Sequence length 62
Comment (Oryzias latipes)
Sequence
IYEKSCANPSQCGRSGQKYSAGVVFNYTNDCCDTDLCNGAGPAAAALAWGVWLLAAVALL
LP
Download sequence
Identical sequences H2L9W5
ENSORLP00000002664 8090.ENSORLP00000002664 ENSORLP00000002664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]