SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000002827 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000002827
Domain Number 1 Region: 8-117
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 9.68e-23
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000002827
Sequence length 153
Comment (Oryzias latipes)
Sequence
TNPYTSGNIASRESAPGIIVASGSIGSELTTTNGSVFITSDAGNTWRQIFDEEYAVLYLD
QGGALVAIRHTPLPIRHLWLSFDEGRQWNKYSFTNTPLFVDGVLGEPGEETLIMTDYGYE
RRSDGRCSPAFWFHPSSMSRSCTTGMTFLNSTG
Download sequence
Identical sequences H2LAC0
ENSORLP00000002827 8090.ENSORLP00000002827 ENSORLP00000002827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]