SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000003387 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000003387
Domain Number 1 Region: 11-207,254-364
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.15e-49
Family Calponin-homology domain, CH-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000003387
Sequence length 366
Comment (Oryzias latipes)
Sequence
VSDTDTPSASMQSSKMKKDESFLGKLGGSLVRKKKNKEVSDLHEEGKNAINAPLLPSGTE
IHPEDALLEENAERIMLDPSSHDNPKFKDLVKTLTEWINSELEEERIIVKDLEEDCYDGQ
VLQKLFEKLSGRKLNVAEVTQSEIGQKQKLQTVLEAVNSVLRPHGWTVEWSVESIHSKYL
VSIVYLLVALAMHFQAAIRLPEHVSVQVVVVKQKLEGILQTAVLTKELTTTTEMMMGRFE
RDAFDTLLDHAPDKLNVVKSSLITFVNKHLNKLNLEVTELESQFADGVYLILLMGLLEDY
FVPLYNFFLTPESFEQKVHNVAFAFELMQDGGLMKPKARPEDVVNLNLKATLRVLYNLFT
NYKNSE
Download sequence
Identical sequences H2LBV8
ENSORLP00000003387 8090.ENSORLP00000003387 ENSORLP00000003387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]