SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000006540 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000006540
Domain Number 1 Region: 17-248
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.16e-87
Family Calponin-homology domain, CH-domain 0.0000199
Further Details:      
 
Domain Number 2 Region: 266-388
Classification Level Classification E-value
Superfamily Spectrin repeat 2.66e-33
Family Spectrin repeat 0.000000542
Further Details:      
 
Domain Number 3 Region: 389-498
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-17
Family Spectrin repeat 0.0000318
Further Details:      
 
Domain Number 4 Region: 839-911
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000385
Family EF-hand modules in multidomain proteins 0.0004
Further Details:      
 
Domain Number 5 Region: 730-758,785-884
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000141
Family EF-hand modules in multidomain proteins 0.003
Further Details:      
 
Domain Number 6 Region: 635-736
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000173
Family Spectrin repeat 0.0000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000006540
Sequence length 912
Comment (Oryzias latipes)
Sequence
HYDNGYDEYDYMMQEEEWDRDMLLDPAWEQQQRKTFTAWCNSHLRKAGTQIENIEDDFRN
GLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALEFITSKGVKLVSIGAEEIVDGNVK
MTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHVSWKDGLAFCA
LIHRHRPDLLDFSKLNKEDPLGNLNLAFDIAEKHLDIPKMLDAEDIINTPKPDERAIMTY
VSCFYHAFAGAEQAETAANRICKVLGVNQENEKMMEEYERLASELLEWIRRTTPWLENRT
SEKTMSEMQRKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMV
SDIASAWQGLEQAEKGFEEWLLTEIRRLERVDHLAEKFRQKATNHENWASGKELILSQKD
YETTTLTEIRALLRKHEAFESDLAAHQDRVEQIAAIAQELKKMCLCARPVSTGKKKTIQN
EFDLESLCSILQKQIPALQQNKSVFQLVQLCLVEYPKLLSPSSNPEDPAVSWLVEPSKLP
GLSSNPEGPAVSWAVVNPPKLPPPPFKPSVSMHPWQVKTPTKKQNSLLNPESLPLSWVAP
KYPGRSNSKVLTILHSHWIKENKLSNAFSSMQSSFSPYIKQRIPHLFYLFVTGQLPHGTV
SHMQSEYEKQIEHVIIAYKPNIDKLEGDHQLIQESLVFDNKHTNYTMEHIRVGWELLLTT
IARTINEIETQILTRDAKGISQQQMNEFRSSFNHFDRYHISPYITEEYKTSANSSENQLQ
DMKKKNGAMETDDFRACLISMGYDLGEAEFARIMILVDPNATGIVSFQSFIDFMTRETAD
TDTAEQVVASFRILAADKKQPYILIDELRRELPPEQAEYCIMRMPPYAGPGAPPGALDYT
AFSTALYGESDL
Download sequence
Identical sequences H2LKI9
8090.ENSORLP00000006540 ENSORLP00000006540 ENSORLP00000006540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]