SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000007022 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000007022
Domain Number 1 Region: 3-185
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-47
Family Calponin-homology domain, CH-domain 0.0000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000007022
Sequence length 319
Comment (Oryzias latipes)
Sequence
MSFNKGPAYGLSAEVKNKIAQKYDLQKEEELRIWIQDTTGCSIDPDFQKGLKNGVILCEL
INKLQPGSVKKINKSSLNWHQLENLTNFIKAITDYGLKPHDIFEANDLFENGNMTQVQTT
LLALASMAKTKGCHSRVDIGVKYADKQQRMFDEEKLKAGQCVIGLQMGTNKCASQAGMNA
YGTRRHLYDPKAHIQPPMDNTTISLQMGTNKGASQAGMTAPGTRRAIYDQKLGTDKCDNS
TMSLQMGFSQGANQSGQNFGLGRQIYDAKYCPKAGELAEDQNGAGSSRDYIPDYQDEGYQ
GYHEEEQVYQEEGTDYQGM
Download sequence
Identical sequences H2LLV6
ENSORLP00000007022 8090.ENSORLP00000007022 XP_004078717.1.28442 ENSORLP00000007022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]