SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000010030 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000010030
Domain Number 1 Region: 32-260
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.66e-88
Family Calponin-homology domain, CH-domain 0.0000008
Further Details:      
 
Domain Number 2 Region: 3882-4116
Classification Level Classification E-value
Superfamily Plakin repeat 1.44e-84
Family Plakin repeat 0.0000000372
Further Details:      
 
Domain Number 3 Region: 3304-3543
Classification Level Classification E-value
Superfamily Plakin repeat 3.79e-76
Family Plakin repeat 0.000000336
Further Details:      
 
Domain Number 4 Region: 3640-3875
Classification Level Classification E-value
Superfamily Plakin repeat 7.5e-76
Family Plakin repeat 0.000000458
Further Details:      
 
Domain Number 5 Region: 2973-3212
Classification Level Classification E-value
Superfamily Plakin repeat 9.94e-76
Family Plakin repeat 0.00000019
Further Details:      
 
Domain Number 6 Region: 2647-2884
Classification Level Classification E-value
Superfamily Plakin repeat 1.83e-69
Family Plakin repeat 0.000000573
Further Details:      
 
Domain Number 7 Region: 4192-4233,4269-4464
Classification Level Classification E-value
Superfamily Plakin repeat 5.23e-68
Family Plakin repeat 0.00000024
Further Details:      
 
Domain Number 8 Region: 276-391
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-23
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 9 Region: 627-729
Classification Level Classification E-value
Superfamily Spectrin repeat 9.84e-18
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 10 Region: 1174-1348
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000288
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 11 Region: 4139-4198
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000178
Family Plakin repeat 0.0088
Further Details:      
 
Domain Number 12 Region: 533-626
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000955
Family Spectrin repeat 0.0065
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000010030
Domain Number - Region: 734-816
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00143
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 1109-1215
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0158
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000010030
Sequence length 4529
Comment (Oryzias latipes)
Sequence
MATQQSFRSYSSDSLGSDGVFIEDQYCQGRLKAMDYRKDERDRVQKKTFTKWVNKHLIKV
QRHITDLYEDLRDGHNLISLLEVLSGETLPREKGRMRFHKLQNVQIALDFLKHRQVKLVN
IRNDDIADGNPKLTLGLIWTIILHFQISDIQVNGQSDDMTAKERLLLWSQRMVEGYQGLR
CDNFTTSWRDGRLFSAIIHKHRPALIDMNQVYRQTNQENLEQAFSVAERELGVTRLLDPE
DVDVPHPDEKSIITYVSSLYDAMPRVPDIQDGVRANELELRWQEYYEVVTMLLQWIRHHI
LVFEEKKFPTSYEEIEVLWRQFLKFKETELPAKEADKNRSKHIFKSFEGAVKAGQVKVPP
GYHPLDVEKEWGRLHAAILERERLLRTEFERMERLQRIVGKVQTESGVCEEQLNQVETLL
QAQKDVRRMSSGKAPQHTAEVEADLEKAEGMIRFLFNDVQLLKDGRHLQAEQMYRRVYRL
HERLVNLRSEYNLRLKSGVAASQIPMTQLHTVQVLQQSSKSTRPELDEVTLRYAHDLLGW
VEDNQRRVDEGEWGSDLANVESQLGSHRGLHQSVEEFRSKIERAKADESQISPVSKPAYR
EYLGKLELQYGKLLTASKARLRYLVELHTFVSAATKELMWLNEKEEEEVNYDWSERNTNM
VSKKENYSGLMRELELREKKVNGVQATGDKLLRDGHPARKTIEAFTAALQTQWSWILQLC
CCIETHLKENTAYFQFFTDVKEAEEKMKKMQDTMRRKYTCDRSVTVTRLEDLLQDAADEK
EQLAEFKTHLEGLKRKANTIVQLKPRNPTTPIKGKLPIQAVCDFKQMEITVHRGDECALL
NNTQPYKWRVVNNKGSEASVPSICFLVPPTNKDAVNSVAGLDGNLQRLHAMWQTMFVDLK
SLLSWQYLMRDIHIINTWNVSMFKTLRVEEYRLALRNLEQHYQEFLRDSQDSQMFGAEDR
LQVESNYKRANQHFHSMASSAEQAQPGDQDESVCRTYLTKIKDLRLQLESCENRTVTHLR
QPVEKEALKACALKTAEQMKVQSELEGLKKDLSSIAEKTKEILASPQPSSSAPMLRSELE
ITLKKMDHVYCLSSVYLDKLKTIDVVIRNTKDTEETLKNYETCLRDVRKVPNEEKEVEDQ
RSQLKSMRAEAEADQAGMDRLQDELQRATAINDKMMRIHSERDVELEHYRLQVGSLLERW
QAVFSQIDLRQRELDFLSSKMKSYRESYEWLTCWLAEARQKQENIQAKPINNSKALKEQL
SEEKKLLEEIKKNKDEIDNCQMSAKAYIDSIKDYELLILTYRALQDPLASPLKKPKVECA
SDNIIQEYVTLRTRYSELLILTSQYIKFITDTQSRLEEDEKASEKLKEEERRKLAEMKAE
LEKQKQLAEAHTISMAKAEREADELKLKMKEEANKRQDIAVDAETQKQNIQQELQHLRSL
SEQEIRTKSQQLEEALHSHTKIEEEIHLIRIQLETTTKQKSTAENELQKLRDKAAEAEKL
RKAAQEEAERLRKQVAEEAQKKKNAEDELKRKSEAEKDAARQKQKALDELQKFKMQAEEA
ERRVKQAEDEKLRQIKVVEEVTLKSSATDLQTKSMPFAQKATELEETLKKEQGTVLQLQV
EADQLRKQQEEANKAREQAEKELEMWRQKANEALRLRLKAEEEAQKKTQAQEEAERQKLE
AEQDAKRRAKVEEMALKQKENAERELEKQRTFAEQIAQQKLSAEEECIRLKVDFEHAKQQ
RSLLDEELQRLKNEVRTTENQRKQLEEELAKVRQEMDSVLQMKIQAEKEILSKNEKSKQL
LESEALKMKQLAEEATRLRAVAEEAKKQRQIAEEEAAKQRAEAEKILKEKLAAINEATHL
KTEAEIALKAKEAENDRLKRKAEEEAYQRKLLEDQAAQHKHEIEEKIAQLKSSSDSELER
KKDIVEETLRQKQVVEEEIQIIRINFEKASKEKSDLEMDLKKLKSLADETQKSKIKAEEE
AEKLKQLAAEEEKKRKEAEEKVKRITAAEEEAARQWKAAQEEVERLKKKAAEAKEHKEKA
EKETERQVILAKEAAQKCSAAEEKAQDVLSKNQQDILAQDKLKEEFEKAKKLAEAAQKAK
EKAEKEANLLRQKAEEAEKQKKAAEDEVAKQAKAQKDAEKLRKEAEGEASKRAAAEAAAL
KQKQQADEEMAKHKKDAEHALKQKAQVEKELGMVKLQLEEADEQKALLDAELQRLKDEVG
DAIKKKKQVEDELSKVKSQMDELLKVKLKIEEENRCLIQKDKDITQKLLLEEAEKMKTLA
QEAARLSVEAEDAARQRQLAESDLAEQRAQAEKMLQEKMQAIQEATKLKAEAEELQKLKE
DAQEKAKQLQEDKKLIQQRLEQETEGFQKSLEAERKRQSELFAEAKKLKLKLKELSDAQA
KAEEEVAKFKKQADEAKSQLKEKEKQESEVVVQNLEMQRLQSTREADDLRKAITDLEKEK
EKLKKQTEDLQKQSEQMVTDQQQQIEQQKAILKQSFLTDKELLLKREKAVEDEKNKLEKQ
LEEEVKKAKALKEEQGHQQKVMETEKKKLQDKMDEALRKQKEAQAEMETKQKEMEELERK
RLEQEKLLEEENKKLREKLLNFEEVQTEKVPEEQLVAMTMVGTTKKFLNGSVEVDGMKKD
GESALAFNGIREKVPAERLFDIGVLTKKDMDKLKKGKVSISDLENTEKVRSCLKGQGCVG
GVLTPSKEKMSVYQAMKEKKISPSAAALLLEAQAAVGFIVNPVKNTLLSVDEAVKEEVIG
PELHDRMLSAERAATGFKDPYTGAKISLYEAMKKELIEKEQAMKFLDVQLATGGIVDPIN
SHRVQLPMAYKQGQFDEDLNKKLNDPGEELKQFIDPSSQEKLTYKQLLEKCTKDAETGLW
ILPIPEKAAHVEQTYTDVETKEVFSKSKVDVPFGKFKGKTVTIWEVINSEYFTEDQRREL
LRQYKTGKITVEKIIKIVITVVEDKEKSSGNVFSGLRAPVPANELLDSKVINKDLFNKLS
NGKISVKEVSEMEAVRKALHGSPSIAGLLNELTNEKIPFYQAMKEEVILPETAVNLLEAQ
AATGFMIDPVKNERVPVDEAVKSGLVGPELHECLLSAERAVSGYRDPYTGKKVSLYEAMN
KGLVKKDHGIRLLEAQLSTGGIIDPVKSYRIPHEVACKRGYFDEEICKILNKNTDENKVF
NDPNSQEAATYAELIEKCVTDKDTGLPLFPLSKKAQKPNEDRQITEAKTKEALNHTTMEL
EHGPFKGRKVTIWEIIHSEYITEEQRIELIRQYRIGQVTIEKLIKIVVTMVVEKEDKTHK
EPCFEGLRGPVTATSLFEAKIIDKTTFDQLQQGNVTPKEVGQTDKVRKYLQGTDRVDGIT
MEGSDEKLSIYQAMKKKILQHNTGLALLEAQAGSGYITDPFTNMKHSVDDAVKAGVVGPE
LHEKLLAAEKAVTGYKDPYTGNTISLFQAMKKELVLREHAIPLLEAQFTTGGIIDPVSSH
RVPSDVAIQRGNFSKQMCKSFIEPSGDVKGFTDPNTLQRATYKQLLEKCRRDPNTGLCYL
PLSKAEAPAHEEKSYQFTEEHAQKDLANTQIEIPLQRFAGKNMTVWEIMNSNLLPEDERL
RLLEQYRLGQITKERMLIIIIEIIEQRESLQSEQSMTCDVIRRRITIEELYSARIIDLQT
YNLLKQEKMTIRELMDMPSVKQYLFGTGCIAGILSDSPPKISIYQALKKGQIKPEVALQL
LEAQAATGFIIDPVKDELLTVDEAVRKGLVGPELHDKLLSAERAVTGYKDPYSGKVISLF
QAMKKDLIPEDFALRLLEAQLATGGLIDPEYYFRLPTDVAMQRGYINKETLDRISEPTAD
VRGYTDPTSDEKQSYAQLLKRCRVDKDSGLCLLSLAGRRLLFKGLRKQITVEELLRSQII
SQKTYNDLTEGNITVEEVSRDVKTFLEGTSCIAGVFVESSKDRLSIYQAMKKNMIRPGTA
FELLEAQAATGYVIDPIKNLKLNVADAVKMGVVGPEFKEKLLSAERAVTGYKDPYSGKII
SLFQAMKKGFILKDHGIRLLEAQIATGGIIDPEESHRLPVEAAYERGLFDEEINAILTDP
SDDTKGFFDPNTEENLTYLQLIDRCWTDPETGLRLLLLKEKKRERKTSSKSSVRKRRVVI
VDPESGKEMSVYEAYQKGLIDQQTYLELSEQECEWEEITTTSSDGAVKSMIIDRRSGRQY
DIDDAITRALIDKSALDQYRAGLLSITEFADMLSGNMSGSRSRSSSFGSSSSYPMSPVPS
IKTPATTWNDPTEETGPIAGILDTETLEKVSVTEAIHRNLVDNITGQRLLESQACTGGII
DPHTGERFTIADAMNKGLVDKIMVDRISLAQKAYIGFEDPRTKTKMSAAQALKKGWLYYE
AGQRFLEVQYLTGGLIEPEVTGRVSIDEAVRKGMLDARTAQKLRDVSAYSKYLTCPKTKL
KISYKDALERSMTEEGTGLRLLEASSQSSKGLYSPYSISGSGSATGSRSGSRTGSRSGSR
RGSFDATGSGFTSTFSSSSYGSPSYSRRY
Download sequence
Identical sequences H2LVA0
ENSORLP00000010030 8090.ENSORLP00000010030 ENSORLP00000010030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]