SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000010118 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000010118
Domain Number 1 Region: 29-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-87
Family Calponin-homology domain, CH-domain 0.0000216
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily Spectrin repeat 7.67e-33
Family Spectrin repeat 0.00000061
Further Details:      
 
Domain Number 3 Region: 513-634
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-31
Family Spectrin repeat 0.00000311
Further Details:      
 
Domain Number 4 Region: 400-508
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-26
Family Spectrin repeat 0.00000254
Further Details:      
 
Domain Number 5 Region: 638-749
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-20
Family Spectrin repeat 0.00000184
Further Details:      
 
Domain Number 6 Region: 849-919
Classification Level Classification E-value
Superfamily EF-hand 3.87e-18
Family EF-hand modules in multidomain proteins 0.00082
Further Details:      
 
Domain Number 7 Region: 750-880
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000016
Family EF-hand modules in multidomain proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000010118
Sequence length 920
Comment (Oryzias latipes)
Sequence
MTAVESQITYTNSYSIHQEETYMSQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRNGLKLMLLLEVISGERLPKPDKGKMRFHKIANVNKALDFICSKGVKLVSI
GAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFH
ISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKFLDIPRMLDAEDIVNT
PKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWI
RRTIPWLENRVAEQTMRAMQQKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNR
PAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLDHLAEKFKQKCAMHEAWT
SGKEDLLSQKDYESASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAA
SVNARCQGICDQWDNLGTLTQKRRDALERVEKLWETIDQLYLEFAKRAAPFNNWMDGAME
DLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMATLGIHNEILKIAQTYGIKLSGIN
PYTNLSPQDISNKWDTVKHLVPLRDQMLQEEVARQQANERLRRQFAAQANIIGPWIQTKM
EEISHVSVDIAGSLEEQMNSLKQYEQNIINYKSNIDKLEGDHQLSQESLIFDNKHTNYSM
EHVRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRVRVQSFSRLL
LTGSSHPVHKTSQKRNGMMDPDDFRACLISMGYDLGEVEFARIMTLVDPNNTGVVTFQAF
IDFMTRETAETDTAEQVMASFKILASDKNYITVDELRRELPPEQAEYCISRMTRYVGPDA
PPGALDYISFSSALYGESDL
Download sequence
Identical sequences H2LVI6
ENSORLP00000010118 ENSORLP00000010118 8090.ENSORLP00000010118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]