SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000012626 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000012626
Domain Number 1 Region: 40-252
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.97e-73
Family Calponin-homology domain, CH-domain 0.0000048
Further Details:      
 
Domain Number 2 Region: 1735-1921
Classification Level Classification E-value
Superfamily Plakin repeat 1.83e-50
Family Plakin repeat 0.00000846
Further Details:      
 
Domain Number 3 Region: 1548-1732
Classification Level Classification E-value
Superfamily Plakin repeat 1.7e-44
Family Plakin repeat 0.0000271
Further Details:      
 
Domain Number 4 Region: 6158-6316
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-28
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 6596-6752
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-27
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 6 Region: 5279-5438
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-26
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 6378-6535
Classification Level Classification E-value
Superfamily Spectrin repeat 4.98e-26
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 8 Region: 269-384
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-24
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 9 Region: 6047-6207
Classification Level Classification E-value
Superfamily Spectrin repeat 4.39e-24
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 10 Region: 4736-4891
Classification Level Classification E-value
Superfamily Spectrin repeat 4.98e-23
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 11 Region: 5716-5874
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-21
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number 12 Region: 6747-6861
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-20
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 13 Region: 7083-7163
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.4e-20
Family GAS2 domain 0.00051
Further Details:      
 
Domain Number 14 Region: 5170-5295
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-18
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 15 Region: 3961-4101
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-18
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 16 Region: 5606-5753
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-18
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 17 Region: 673-801
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 18 Region: 4417-4532
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-16
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 19 Region: 1244-1368,1395-1418
Classification Level Classification E-value
Superfamily Spectrin repeat 8.34e-16
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 20 Region: 6994-7074
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000423
Family Polcalcin 0.044
Further Details:      
 
Domain Number 21 Region: 4950-5107
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000526
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 22 Region: 3717-3828
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000102
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 23 Region: 3848-3954
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000131
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 24 Region: 4158-4278
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000238
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 25 Region: 4342-4456
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000654
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 26 Region: 5877-5987
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000013
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 27 Region: 5438-5549
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000209
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 28 Region: 607-701
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000249
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 29 Region: 779-879
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000119
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 30 Region: 6871-6942
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000518
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 31 Region: 4632-4731
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000201
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000012626
Domain Number - Region: 3464-3581
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000144
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number - Region: 3241-3319
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00036
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 4535-4633
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000432
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 1068-1171
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0117
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 2139-2238
Classification Level Classification E-value
Superfamily Plakin repeat 0.0458
Family Plakin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000012626
Sequence length 7371
Comment (Oryzias latipes)
Sequence
VMAYCAPLGYVLSDEQEYLQAYEDVLEKYKDERVRIFKKHFHSSLSLSWLQVRKHINDLY
EDLRDGHNLISLLEVLSGDTLPRERGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITD
GNPKLTLGLIWTIILHFQISEIHVTGESEDMTAKERLLLWSKQITDGYVGVRCDNFTTSW
RDGRLFNAIIHKYSRPDLVDMSRVSAQTNRSNLEQAFSVAEQLGVARLLDPEDMDVQSPD
EKSVITYVSTLYDAFPKVPDGVDGVSPNDVDIKWVEYQNMIKYLSQWIKHNVAVMSNRSF
PNNPAELKALYTQYIQFKEHEIPQKENEKTKIQNLYKMLEMWIEFGRIQLPPGHHPNDVE
KEWGKLIVAMLEREKSLRPEMERLEMLQQIANRVQRDCVNGEDKLALARTALQSDAKRLE
SGIQFMNEAEIASYLVECENILRQQVVDIQILLDGKFPFADQLVQRVSKLRDDLLTLRAE
CSSVYSQSRTLSTEQTKMMISGITQSLNSGFSQSINSSLTSSIGQVLTPSGLSTPGSTFT
SSLTPCLTPSLTPGLQPSSVQSYMGSGGGMEPGSLMHLKHMQIRKPLLKSLLADPNMTEE
EVNMKYVQDLLNWVEEMQLQLDRSEWGSDLPTVEMHLENHKGVHRAIEEFQMSLKDAKLS
EIQMTLPLKLNYSDKLNKLERQYERLLSCSRERQNNLENLHDFVSQATQELIWLNEKEEE
EVAFDWSDRNSSISKKRDYHADLMRELDEKEEAIKSVQDKAERLMFKNHPARLTIEAYKA
ALQTQWSWILQLCSCVEQHLKENAVYFEFFSDAKESMDYLKNLQDSIQRKYSCDRSSSLH
RLEDLIQESMDEKEQLLQYRSTVAGLVGRAKNIVQLRPRSPESPLRCSIPVKAICDYRQI
EITIYKDDECVLANNSHRAKWKVINPAGNEAMVPSVCFTVPPPNKEAIDMATKTEQLYQN
VLALWHHSHINMKSVVSWHYLMGDIRAIRNWNVSSIKTMLPGEHQQVLSSLQSHFDEFLE
DSEESEVFTVADCAQLERDVAGCKEYYQELLRSAERAEEHEESVNNHYISEIRNFRMHLE
AHEEHLIRQIRTPLERDDLEQSLQRITEHERKMAELERLKEDLDVLKGKCDLFLRQAAGS
PSVSMLSSELSTLLQNMGQVSSMSSIYMDKLKTVSLVVKHSQNAETHVKTYESKLYEEDA
MNSDIRSIESVISTLKQWRAEIDERQEVFHDMEDELQKARVISDRMFKAHNERDFDLDWH
KEKADQLSERWQSIHSQIDGRLRDLDGISKLLKHYRESYSSVDEWIRELETAQLKAQENK
PDDSKALAELLNKQKVLVSEIEQKQSKIDMCQKYSEQYSCAIKDYELQLMTFRAMVDSQH
KSPLKKRRMQSSSDAIQQEFMDLRTRYTALVTLITQYVKFASETLKRAEDEENRKAFERA
ENVKKAESMELLKTTGDLEIRRLKQQEETRGPPEKSDDLQQETVNTKKSVSELQEEIRSL
QRGLSSNSEKVAENLKKEIHTLQNDKNALLGSEVKTLKENLQRAQADTEQKPIDKPTAIT
GVYVESSKKKISFIEAAEKGFLAKTYALEFLEAQAATGSLADLATGQIHSVAEAVEMGII
DACMKDKLIEAEKAVRGYVHKGRMLSVFQAMEILEVQVATGGLINPETHTRVPACIAVEQ
GLLSKEILQSLYDPVSNPRGFHNPDTGQKAYYSEVLKTCLYDVDGGVFLTPFDNRSGRQI
CLESAKRLSILQGFQQGLTDRATALRLLESQACTGGICDPSSGEKLSLCDALKRGLVDEG
LNQQLQPFEQAYNGIVDPLTGKTLTVSQAAQENLFPKNAAFRCIEFQLLTGGPIDPVTHD
RVSPEEAIQRGLVDKVIASSLKDEKHHTKALSCPKTKRRMTFKEALERSVFDCHTGLRHI
NKQRSVDEEKREHGDKVSKLLHWMSDVKRTVNNDAKALKDTNANTDASNKPKLQEDASLF
TSINSYVSVEEMVAKKEQVAEALKGTQMMLNKHANFASNAPIRQTLQMSQSLSSNLTFYI
FLQGFKTTQCLMDEVTWAAFPESIMTPNPSLSGTNDHMDREKNVMYQSAPKHPSQYEADK
CIQSLHISSVSLSDVAAARKGFECEELVIKVIEISEEADGVDVWYTGDTLTLDKAFECSL
IPASLYVEILQRQKINHGFDENLFLLEKQLEPCDIEGMILTCLSRPKSNEPERNVKTLRA
VNVGLKDQKIPSRQLSGQGHQQQFLGLVLPKSDQTMITSLQHDKQINVISSGLLSNPVKM
AAFYIPEYSEIPDELPDINDLNEKFSSWLIHKNVSVEGWQCSSEGAEVSKPTPTEVEQLF
ISHLMINSYIDLKSAQRVLILDSHLTRVAQAFLEDLKPTGVKMLSHLNRGIENTFYSDDV
FKDNVNMTFDENSHLLFEPHSFSSVSTKTKRFDAKPFTADVLDNGGSVNTIEPMVQDEGQ
SKDSSNWNSLNYSEQKKYKNESEFEFENRFSLDGQSSPEISGSSKFSMKSQCDVIDSESS
FTSSLQKPYFSKSVRVDNSQTEFLSFDHLKEKESPSDYSVPSMYGQRAAGCPSDKDPEGY
CDFTEAFNRRAVDVKFAPELDEPQLVEEMCILKAEEETACGLNRSNPTKILQNLSTFPCN
QSSDLFPIVSSENNNIDPQNSVYSHGNTFAFTSEGGRIFLPHFHKAENVQEPPERKVAVM
FLDSPKEYSESADIDNEKKSETRTDREHHSHQHEMNSPSSWSETPADCCPQAVNGTSMLI
ISEDLTGGAGISGTLVDSSALTESVLTPYVCSDTQSQHITSAFPSCQSSSPPTDDVLTDG
LDAGLFVVPSFHNDMCAKNNTETDRSDARSSLDGDPARSGECSSCSWGLHADGVMSPLED
CSNYDIRCTENSNRIASPQQPGPLLRADFIVEPKPCCFQNAQIEILTPPQLLSSSQSPTA
LSNLNAEDISHMRCDMTDSIQTDEDFVGSNSKRNYSEFQNESLSLPRQHGGTCEETSNDN
GNALCSDPPDISFRHPITEENAGSSCQADLKKVAANVLSESCNASTGTSSESHSNSSQIV
SEDCNENLLKDSVLHKDRDDLELLDSQKSNAPGGVVDSSSLCLSSVIESQNTFDSNSKNK
ENSQLVCQEDAEHLDAPNFQQRFLQLFQTVSSGQDFSVLQEMMDSLSSGLGTSSMEERWH
TLESIQEESLEEEEEAAEEKSRAHYVAATVHRTSAHVSDFSEKPLLFHSFRQTFYFQFTI
QDYLECTGKLQDHADALEDLRKDLSSQETISKNMEELQIYLEECQVLESELSRVGDVLIA
DVDKAKQLLNSADEDLPVQVHKDLALAYRHLEPNFTAVSRCVQRRRRPSFKQWMKDGSVS
SDSFLHFKKESSKAYSELFHLLFPKDTEEKLLKEARLKLEDVTFDIQCFISENAQFLSPA
QSSYLLKFLTSTQRALREQTERIMAQRSALDVALNTKDENQECQSFSAKHKEFTDKLEDM
CDSLTLTENCLIGHKQEAKSIECIPDLQQYQQEHQALQKDVLTNASALNEVISSSKKYLE
ENRNKMTPDQIAIIESKLEEAKSKASLINQQAEESKKDLEKIVTTTIKQESEKAAAVERL
EENKNKIEGLLDWISNIGNENQSSQDHTDHISKENGNLPEETSAKGLIDEHDDANGNAMQ
TSETDLAGKNRRQNESGLDLDDQYSKIKARHQEILSQQQNLIMATRSTQALLDKQANVLS
SEEKEALQKNVEDLQERYEASLTQAEQQMKQVQCVQEELKKFKDDCEEFEGWLSEADREM
EELGAPSASLNILTDKLQQQKSFSEDVISHKGDLRFITISGQKVLDAAKACGLADPNNPL
LHIDTSGACSAVKEKLDSAANRYKTLHSQCNTLGNNLREVVDKYKKYDDTSTDLLKWLNN
SEDEARKQQSEAIAADPQMLQKQLEETKALQGQMMGHQTAVETLRKTAESLVTCEGNLLS
NQDEIQEIVDDIVERYDNLSKCVSDRNEKLHVTLTRSMSVQDGLHEMMGWMEGVEASLKE
NESIPLDSAVLGDILSKKVALEQDIAGRQSSILTMKEKVRKFAETADPSSAVALQSKMDA
LSQRFSDACDKHKQKISQLEEVKEKVEQFENTAEKVHHVVEKRMRELHETDGPGKTFSEM
SQLMQSIKEDMSGCGNDMEKLQHLSKELSGLNSDGNKTTLQSKLDHLSGIFNTFKDTAKE
KEEELSSCQDQLGEFRCAATELNQWLEETNKKVPAVLPSSSEKNLEKDLHTVNGLLEEWT
SKGPAVQDLNSKGSALCSLITFITFPAKAKILNKSASALTNGGDPASHIYLTNKELMVIQ
QNMTFVSEGYAKLGETLKSRAEQMSNLLQEVKEVQKETEDMMTWLKGMKNTAASWNDAAT
EKKSVKTQLEQQKSFEDGMKQKQEQLLKLRERLLGLISTHPNSPEAAKWKQMLAEIDTAW
AEVNGSVEERKLHLEQSNKNLDVFQTTEKQLCQWLSEKELMMSVLGPLSVDPNMLKMQKQ
QVQILQNEFKSRKSQYEQLEEAASAILRSSVDQEPSSGKLVKEQLAAVAQKWQGLTGQLD
QRDSLIDQGVVKTGQFQELLKSLSHTANQLENQLNNHHASSTQPDVVRKQLEDAQNISAQ
LKEELKKLKQAEAINAELSAMVTEDYLKADLARQLESVSKPIKQLEDKAAKRIKQLNLTF
ASSQQFHKTSKDFESWLGKMLCHQSEHQPISAKVDVLQQTIEEHSKLQRVLKEEAYNRIV
GEGERLLQNTDGAEKLALQGQLTTLSTSWDEVKKSSAEHGDKLRTALLRSQKYQEHAEKL
SSWIQDCEASVDQIKLVLDLVRTENSMSQVKALQRDIDKHRGLVDQLNADVESLTELANT
DTDAVKEEKENINRRVEKLGEGLQSKRESLEKISVTIKEFSEALREAKGQLEGAKKQLNS
YESMGVQAHSNKNLANMKAQQKSLEGVQNQVEHMKTLARDLVVDVPDAEGVTDLLLQSDS
VEKDYRSLNKKLEETCQELESKLQGIGQFQNSIREMFTCFTELDDELDNMPPVDLDLTTL
KQQQDNVQKFVAKLQELMANTINARDSCRKMLETESSPDLMGLKRDLDALNKQCSKLLDR
AQGREAQVKSTLTKLGELYDKLHHVEDKLCTAVDKEASQEAVGMETEVINQQLEAFKALQ
KENIEPLQTQLQDINSLGQSLIQNAANGTSTKKLEDDLQDTNFKWNTLNKKIAERSAQLH
EALLHCGRFQDALESLLSWLTDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKPT
VELIKKEGGKVAELGESVDKEKVAKEIEGLGQRWDTLLKKAESRQRQLESILVVTQQFHE
TLEPLSEWLAATEKHLANSEPLGTETSKLEDQISQHKALEEEIMNHSKDLFQAVSLGQML
KTVTSVDDKEFVQCKLENIQAGYIELQERCRRKADMLHQALANAQLFGEDEVALMNWLNQ
VHSRLSEVSVEDYKTDTLEKQLAEQRTLQSEIEFQKKNVDQAIFNGVELLKQTTGDEVLT
IQGKLDGIKTKYAEINSMSDSVLKTLERVLSLSSKLQHTHEDLSAWLKKAEAEISLFAEQ
EPVGEQLIHSQNRQKALLKETKDQKPVVDKLNELSGSLLDLIPWHTREGLDKLMKEDNER
YRAVCDAITWQVDQLDADILKSQQFEEAADAELLWLTEAERKLLSMGEIRLEQDQTTAQL
QAQKVFSMDIMRHKDAVDEIVKTGKMIMSSKNAEEKEALKAKTEAILEKYGIISQLNSER
YLQLERAQSLATQFWETYEELWPWLQETIRSFGQLPAPAIEFDTLRQQQEELRQMRELIA
EHKPHIDKMNKTGPQLLELSPVEGAPIREKYTASDKLYTKLKADVTQRAATLDEAISKST
QFHDKIDSMIESLERIAERLRKPPSISVEVEKIKEQMNENKAVSMDLEKLQPSYETLKQR
GEEMIARSEGPDKDLSAKGAAVQDKLDQMVFLWSDIQALLEEREVKLLDVMDLAEKFWCD
HCALIATIKDSQDLLKELEEPGVDPSVVKQQQEFVEGFKEELDGLQEDLDVVRNQGAELL
TACGEPDKPVIKKSIDEVNSAWENLSKTWKERVERLEEAMQAAVLFQDGLQGMFDWVDIL
ESKLDLMSPVGTDLETVKQQIAELKEFKGEAYQLQIEMERLNHQAGLLLKKVTEEADRCT
IQDPMAELKMLWNNLDEKIISRQHKLEGGLLALGQFQHALDEVLAWMSHTEEMLSEQKKS
AGDPKAIEIELAKHNILQADVMAHKATVETVNKAGNELVESSAGEEASSLKSKLENLNQR
WKAILKRTEQRKQQLESSLLQAQGFHGEIEDMQQWLKDTERQLLASKAVGGLPDTAREQL
NAHLELCSALEAKEELYQELLNKGTQLLALTPESSDSTTEQDLTNLKEKWEAVQAKVAER
KNKLEEALKLATDFHNSLQDFMVWLTQAEQTLNMVSPASLILETILFQIDEHKMFVTEVN
SHREHIIELDKAGTHLKYFSQKKDVVLIKNLLLSVQGRWEKLVQKSVERGRLLDDARKRT
KQFHETFNKLMEWLDESERTLDSEVEIANDPDKIKTQLAQHKEFQKALGSKHSVYDTTAR
TGRALKDKTSLRDDHQKLDDMLCELRDKWDTVCGKSVERQNKLEEALLFSGQFTDALQAL
IDWLYKVEPQLAEDQPVHGDIDLVLHLIDNHKVFQKELGKRTVGVQALKRSARELIENTH
DDSSWVKVQMQELSTRWETVCNLSVSKQGRLEQALCQAEEFHSTVHILLEWLAEAEQSLR
FHGSLPDEEETLLGQIEQHKEFMKKLEEKRVSVNKATSMGEAIISICHPDSITTIKHWNT
IIKARFEEVQAWARQHQQRLNLALKELLATQELLETLLNWLQWAEANISNKDMEILPQEI
EEIKTLIAEHQVFMEEMTRKQPDVDKITKTHKRKAAAEPPIQSQIPVLNKGRTGRKRSPT
QAMYASTTQTPIETKNPRVNLLLKEFANFDFDVWRKRYMRWMNHKKSRVMDFFRRIDKDQ
DGKVTRQEFIEGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVAALHPNKDAYKPLT
DADKIEDEVTRQVAKCKCPKRFQVEQIGANKYRFYLGNQFGDSQQLRLVRILRSTVMVRV
GGGWMALDEFLVKNDPCRVHHYGSKMLRSESNSSITQSPIAKGRTNVELREKFILPEGTT
QVMASFRYRGRRSRPSSRGASPNRSTSSQSCLIPVNQATTNTAKSTTVQGSKLRLPGYLS
GKGFQSAEEGTLINAAVLKARTQMAGEPKKSSSRPGSKAGSRGSSRRGSDASDFDISDIQ
SVCSDASETVGESARGTPRSSARQQGGKPSKIPTPQRRSTPTSKLAKVSKR
Download sequence
Identical sequences H2M2I3
ENSORLP00000012626 ENSORLP00000012626 8090.ENSORLP00000012626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]