SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000012784 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000012784
Domain Number 1 Region: 3-107
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-34
Family Calponin-homology domain, CH-domain 0.0000535
Further Details:      
 
Domain Number 2 Region: 179-206
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000713
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000012784
Sequence length 967
Comment (Oryzias latipes)
Sequence
MSAVKALQQWCRVQCEGYRDVSITNMTTSFRDGLAFCALIHKHRPELINFNSLSKEDVYE
NNKLAFKVAEEKLGIPALLDAEDMVALKVPDRLSILTYVSQYYNYFHGRNPIGGMGAIKR
PADGPMGETPGKKNSAVASKVFPGSKDARENSPPPFLNRTRPSPSPKQSRNALQTGTLSN
KCASCNTHVHLVQRHLLDGKLYHRNCARHYVKEGKLTLHDMDNKITGEKRLFSKCSIGLS
ESTIPKSSALEISQKSQRKASVHRCSLDWRIESIVKLWTDFKLNGAQQRFRIGHCCSFLF
LRQLSPNTSSPLRDLPTNNYVLKPQPDASKTRTTSPAQTPIKAGPSWLTKQPATPSSISS
TSPPSSTVASAAKERMPLVVSKPTVSHVTRNTSSITTPVPAPRSSMTAAKTKETKLKFLQ
AEKPSNPQEKATTTIKLDINKGHSVTAKKPESTVGQAVTLFVSVKDQNKGATVAKTTGVG
ETVSSKQTDSDSNKKKASAAAFLSKKITEENNNDTKPQWMNVALRKTDKPQPQTETTKAE
TEAPRGRIRLKANPSLLADLQPLDNPSSAPSGRSPEQPSDKGGLKSGKASTNTLENFINN
NQKMCVIESIGRKSLYLICICHKKNIAKNQQSDMVLLHSLCPANQSFSNNESPVDWRSKL
KPVSKEIKEAKVFPQMLLGLIQVLHGATHAQCSEFLSLCDLCSCSCQIKLRPSPTPHSAS
SSANSHSPKVLEKSLKPQSINGTKPESKGTKSTHSLPVWRVVSVFSRTLSSKQEAAAAVE
DDSISRRVQTKPNYIPREEIIKELQAIEENVNELERRGVELEMKLRSEEEGADDSVMDEL
MEEWFSLIRNKQVAMRRESELVYIGKTQDLEEQQPSVEQQLRRLMDKPEHLKTEWDRKKE
AELMEKLLEIINDRNAIVEGLDEDRLREEEEDEKLNKMMMDFNVKKEKAKKKSSRSRLFS
WGNKKEG
Download sequence
Identical sequences H2M2Y6
ENSORLP00000012784 ENSORLP00000012784 8090.ENSORLP00000012784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]