SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000013946 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000013946
Domain Number 1 Region: 8-95
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000462
Family Calponin-homology domain, CH-domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000013946
Sequence length 2172
Comment (Oryzias latipes)
Sequence
TEMLSVGVKALLSWVNSVSPSDGEVTINDLQDGVVLVKLINMLLCHIRRKEPVSSLSDSF
EDRYKLIADFLEKDCRFCSTEGTDISWTNIRNGKNLSVELAKVLLVLVYHNMMNDCCTLH
VLESDVEPQSDVSCVLGSFVMEKEGSVYLSDSLDGYLARKCKSQTSLPPFHYSDDDSPVF
QRRQKITFVDMETVASSSSISSLGAGSFKSPLAEIMNTPKFQMRKMKRQLLKEREYRDDL
TKELSAKISLVALRESQISQLQYRLDKLKEEQSEEEAAIRKQISDLETKNNILQTRLNEM
LKENKELKLTSSQTERKVDELAEENGSLSSQMRAVCSQLALFKEEVGRLTESQAAADEEW
KTKTKQLEAELNQATAQKELLSEQGQILQGKISCLEEELRRVGKEVVGENMGPVMELLTN
SLVSVKHLLYRKICQREDLEMEIQRLKNELESSLCSIQKAEEEIQTKNLKMVEYQQEMLH
HKELLEQHKNHTDKLIQAKEETMDQLKRDMVKQSEVLHQQIQELELRLESVERQKAQQMS
RLQQDIAALQHEIETLKEKQKEKDDLLRQTEDNVKDLEGKLSDASSLLSETEQNIKNLSE
EIEHLIDEKKRSGEEIQSREEAYTKLLQEKSEEQDVLNDKIQALTARLEILGSSLRQAEQ
EVQLKEDLVAKTQQAHSQQRCEFEEQISRCEEEIQRLNAEVQEKSQSLVELRDASSQRAE
SLEQEIAVLQAQLQSLTDSLRTAGDRAEAQEAMLAKQQQENEKQAELLQQQRSASEEELK
NLKQEVQTKEEAISLLRNQSSEQAELLNQKIHHLKQQVESCSSSLKRAEENLQSKEKVFA
EEKLQTARQLVEIQAQMVASQDEVKRLNVEVDAKEEQLVQLRMETASHAELLHKEIEALN
EQIQSVNSSLKAAEEQVKAKEGLMAKQDEENSLQIEEHKRNCAALEEEVNGLRRDIHTKQ
EEVEMLKAERSKEKEALMSLQEEVRGLNASLKSSGERAQVQEKMLAQKELELSEVKETFE
EKVKTSEDEVQRLLEVMALKEDQLVTLKKEEDARSEFLQQEITFLKSQSDSLTKAEEEVR
TQLAKVTKQEQEQAHQVEILQQQLSASEQMMRTMMLDVQTKEEEMSLLKNVSSEQAELQL
QELNSLQEQVEGLRSSLKTAEESLRSKEDALVEQREYSTHQIETHKEEARRLKAEVNQKE
EQLAQLKTKAAAHKDSLQQEIEALKMQMRTISNSLEIAEEQVKAKEDLMAEQQEGYMLKI
QELNKNCAGLEEEVKELEGCLQTREAEVERLKAENSKVSEVLNSEIQTLREEKQKLSETL
EAAEEHVRSKEKLLVQLEKELSQKEQTLQDMMTTSKEKIRRLLEQMNEREEQMVCLKEEE
AKQSDVLQEEIRSLKIQEQDRNHQVELLQQHLSASEQEVRNARNELQVKENQMFLLKTEN
SEQTSILQQQTEALQLQIQNLKGRMAAMSEQLQAKEEKLHETQQESVQQMNLLQQQLVSA
NAELTQHKETLAANLKIREEIQELRVSTLREKEVFIQEKETLIAQILQVEKDKKALEKEV
QAVVLEKERLAQTNQAIERQNVASRKLESLQQQEIQMLKTERDRLLKAKEKMEESEKIKR
DLQEQLAAKAEAAEHFKAQMEKAVSHYNGKKQLLQKNQEEMMELKHSLEVKEQEVKAMLM
EKKLLQLDLDKVQSNEKKLKSAVASLEAQVGSLTFELYLKKKSKLHTSIRVSGSRFGVCT
RAQVKKSISSDSLEQSSLEDSLNSTRKRQPWKPSIDSSTPLVRTSERLAAKRSGPYAESL
ETLYFTPINARQKCVESDIKPINGILLVCFKKNPTSSVKRRRTTQVINITLTKRTPGCNE
EEETFYSLPSARSQPNLASFPSGSTSDAPAGQTSTASDRLIGLPGYRRSTIHSHSSPTAA
STFCVGAENEPDGGPEDWLRIAELQARNKACLPHLKSSYPIESETGCSGGLVFTDQDLRL
GDPSDTIRRASMMPGQLQDSLVSHRQSLMSGQMGAAAGTRSHRLSLMPGQLPSKNVSCAQ
VDLQRKGRASCFPRPLTPKNKNILGGPSSALLQPALSPVSVNTADRRQSMMFTIDNTPKN
SSYLKKGLTKLRNSTRKSPSTASRKTLAKTSAPKGQENTPRRKARDGAGKADGFKTPQVK
GKPAQAPGRSAK
Download sequence
Identical sequences H2M656
ENSORLP00000013946 ENSORLP00000013946 8090.ENSORLP00000013946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]