SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000015214 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000015214
Domain Number 1 Region: 189-389
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.2e-48
Family DBL homology domain (DH-domain) 0.0000000335
Further Details:      
 
Domain Number 2 Region: 381-505
Classification Level Classification E-value
Superfamily PH domain-like 4.66e-33
Family Pleckstrin-homology domain (PH domain) 0.0000185
Further Details:      
 
Domain Number 3 Region: 113-186
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-24
Family SH3-domain 0.0000517
Further Details:      
 
Domain Number 4 Region: 6-66
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000889
Family Calponin-homology domain, CH-domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000015214
Sequence length 810
Comment (Oryzias latipes)
Sequence
PLQIYPEPKNDGECLSNIKEFLKGCTSFRVEPFEASDLLLGLNFSKVLNSLVALNKVTAD
IGVGSDSVCARHSSAHRIKSFESLSSQASLGRSSKLLQSQFRSLDMSENSGQQLLVKARF
NFQQTNEDELTFNKGDIINVTRQEEGGWWEGTLSGRTGWFPSNYVREVKGSDKQVSPKSG
TLKSPPKGFEPPAISKTYYNLVLQNILETETAYSKDIQSLLTNYLRPLQNSDKLSSSDVA
LILGNMEEISTFQQMLVQSLEECTKLPESHQRVGSFFLNLMPQMKALYIGYCSNHPSAVN
VLTQHSEALGEFMEGRGAVSPGILTLTTGLSKPFMRLDKYPTLLKELERHMEEIHLDRPD
IQKCMVSFKNLSAQCQEVRKRKELELQILTESIRLWEGDDIKTLGSVIYMSQVLVQSPMT
EEKSERYLLLFPHVLLMLSASPRMSGFIFQGKLPLTGMMVTKLEDCEAHKNTFELNGTLF
DRLQVICTNQQDLQDWVEHLTRQIKHATATAPSHKPLTVPCHTLPSHPVTPSRHAEGRAM
TVAPTYHTLPHPSSHGTSHSTMMWGPLEPPNTPKPWSLSCLRPAPPLRPSAALCYKEDLS
KSPKSVKKLLPKRKPERKQSEEEFALRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTW
QGTDLMHNHVLADVDRSCAESPGRRSSMSRPELSSDLSEDSDYDSIWTSHSYRMGSVPRK
RRETGLHVIIPGEDKVFVEDPSRNGPNALEEKSLVDVVYALRDEVQELKQDNKKMKRTLE
EEQRARKDLEKVVRRVLKSINDPTWDETNL
Download sequence
Identical sequences H2M9M3
8090.ENSORLP00000015214 ENSORLP00000015214 ENSORLP00000015214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]