SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000015275 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000015275
Domain Number 1 Region: 657-960,997-1051,1094-1149
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.68e-67
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 1147-1265
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000173
Family Motor proteins 0.021
Further Details:      
 
Domain Number 3 Region: 1565-1637
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000319
Family Motor proteins 0.021
Further Details:      
 
Domain Number 4 Region: 1491-1565
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000558
Family Motor proteins 0.036
Further Details:      
 
Domain Number 5 Region: 2078-2150
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000345
Family Motor proteins 0.044
Further Details:      
 
Domain Number 6 Region: 2215-2296
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000664
Family Motor proteins 0.049
Further Details:      
 
Domain Number 7 Region: 1848-1930
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000109
Family Motor proteins 0.054
Further Details:      
 
Domain Number 8 Region: 1997-2078
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000109
Family Motor proteins 0.051
Further Details:      
 
Domain Number 9 Region: 1414-1492
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000143
Family Motor proteins 0.038
Further Details:      
 
Domain Number 10 Region: 1931-2003
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000159
Family Motor proteins 0.049
Further Details:      
 
Domain Number 11 Region: 2573-2717
Classification Level Classification E-value
Superfamily ARM repeat 0.0000219
Family Regulatory subunit H of the V-type ATPase 0.057
Further Details:      
 
Domain Number 12 Region: 2151-2224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000451
Family Motor proteins 0.054
Further Details:      
 
Domain Number 13 Region: 1712-1784
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000823
Family Motor proteins 0.047
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000015275
Domain Number - Region: 1638-1710
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000106
Family Motor proteins 0.031
Further Details:      
 
Domain Number - Region: 1772-1856
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000345
Family Motor proteins 0.042
Further Details:      
 
Domain Number - Region: 1351-1407
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00255
Family Motor proteins 0.036
Further Details:      
 
Domain Number - Region: 2297-2395
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.025
Family Motor proteins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000015275
Sequence length 2794
Comment (Oryzias latipes)
Sequence
PVLSLIQFSKPPFVTFGTVKLGTSKSAVLRIENPTEDVEADVTVEKIASTKGFSVNHNRF
TIEPEGSFTLTITWTPTEEGGIRELIVVNANGILKHQAVLLGKAEATKKKKKSLWDTIKK
KNGEGTKTSKAKERSISNNYNHVESNSLIQEDSLGSPPEKCENKDLAKILNQTLSPIGTP
ERFKKLMPRIQSESPPPASAKPDTDSVSTGEPVVSLREALAVIGSDLSQIYTSPREISSS
CEYSDSLESKGGRSENDDPRAIPDSPELPEFNEQRLTFFVSKKSTTSDDHKTVEKVKKTT
FTSATVIKSKASGDSNGWSGRKIRKSRRRLLEKSLELSGSSGQSESGPDTPNLPVIAADT
GASLIHEKHEITEFASSSSTPRPRTSSPPIAFPISSPICIALSHTSISASPLPPAAPSPI
MFAIASSPPVGSSSPLHPSLLPSYQQSVPATPSVHEDSFPVHVAAICKKRKSEEHLKCDR
KFEDPGKPDQGKRSRVVTAKLEPPRSVRDRTSNAQRQRATVDVTCTQRGVRSSTYTNSLK
TWTGDASVRRTKVVAVAQSKLTFIKPTQTALPRHPMSFAAKNMFYDERWIEKQERGFTWW
INYVLTPDDFKVNPEVNKASAVSLAIGSDKFNVPRAPTKEEMSFSTYTARRKLNRLRRSA
CQLFTSEAMAKAIQRLELEVEARRLLVRKDRHLWRDIGERKKVLNWLLSYNPLWLRIGLE
TIFGEFICLESNSDTLGLAMFILQRLLWNPDIAAEYRHHRVPNLYKEEGHEEALSRFTLK
KLLLLVCFLDKAKECRLIEHNPCLFCVDAEFKATKDLLLAFSRDFLSGEGILPRHLGYLG
LPVSHVQTPLDEFDFAVKNLAVDLKCGIRLARVMELLTLDWRLSAKLRLPAISRLQKIHN
VDLALQVLKAKGIDLKDEHGSIIDSRDIVDGHREKTLSLLWKIIFAFHVEVILDENQLRQ
EIGFLRRTLRTKRRLARVRADQGIQPSPMKTRVSYEHTSTKITLLMEWVRAVCNFYNLKV
ENFTVMFSDGRVLCYLIHHYHPSLLPEASISHSTTQTVEGSPTGRLELDCSASDSDSSFD
ALKKGGPDSPSVVFKELLENEKSNFKLVNSAVAFLGGVPAMINLADMSNTIPDEKVVMTY
LSFLCARLLDLHNETRAARVIQGAWRKYRLKKDLQLYEERNKAALKIQLMVRRFLQKRRA
ARRAQAAVLIQSAWRGFLARKILRMQKEALLRAVQHEAATIIQAHWRMFSAFKAYNQLRY
YTVSVQAQWRMRRAAATYGKVCRAVRVLQKYSRAWALSRKQRDRYLLLRSSVVKLQRAFR
RWKATKIEEENRAAVVIQAAFKKWYSHRMATKSAAAVRIQSWFRMQRRRFQTLKLQHDSA
VVIQRAFRGHVVRKQVLEMRQAAVVIQQRFRASVKRNAQRRAFLTMRCAAVAMQAVFRGK
KARELLKKQHEAATVIQAAFRERAARKKYLALRKAAIRVQRRYRATVLARKTKTQYFALR
KAALVLQASWRGRADRKKIEMWHRCATLIQASYRRHRIHAEFRSKKGAALVIQRRYRAFV
AGKDIRGKFLQKRAASIALQAGFRGMRVRSELKRKHQAATVIQSWIRRFLCEKRYFLMQC
AAIIIQSRYRALLLCRASQKEFRKQKQAAIKIQAVFRGLRVRQEHRKRIAAATAIQAHFR
MYKMRMAYLAAKFAAIIIQERYRAKKLRDQERQRYKRIKSAAVVIQAAYRGCMVRRRMAE
RHRAAAIIQRMFLTIQARKQFLKLKSVALICQRRYRALSLARKFHLDYLSKRRAVVCLQA
ACRGYLVRKQLHVRQRAAVIIQSYFRMHQRKTRYRRLRWACRVVQERCRANKKMRVDMHA
MKAVKNAAIVLQSAYRGMKSRRILQQEHQAAAVIQRSFRAHCEHRSYLTLKASVLNIQRR
YRANMAAKTQKSQYQQIRKATILLQAVYRGQQVRKEVGRWHRAATVIQSAFRRYREEVKF
QAMRLSATIIQRRYRALLQGRTDRRNFLNMKCSAVVLQAAFRGHRVRTDVANMHSAAVVI
QANFRRFREQKTFRRRRWAAVVLQQRFRAQKQKRHAVKQYHKVRKAAVLLQAAYRGMKSR
RILQQEHQAAAVIQRSFRAHCEHRSYLTLKASVLNIQRRYRANMAAKTQKHQYQQIRKAT
ILLQAVYRGQQVRKEVGHWHQAATVIQSAFRRYREEVKFQAMRLSATIIQRRYRALLQGR
RDRRNFLRMKCSAVVLQAAFRGYRVRTDVANMHSAAVVIQANFRRFREQKTFRRRRWAAV
VLQQRFRAQKQKQNAVKQYHKVRKAAVLLQAAYRGMKSRRILQQEHQAAAVIQRSFRAHC
EHRSYLTLKASVLNIQRRYRANMVAKGERKIYIQKRQATMLIQRSFRAWKARQQLNESLL
QMHQLLITVKCICQVVQAARAEKRLRFTAVVFHHLCAMKIQRALRAHWALESAKKQINSV
VTIQRWLRARQQRRHYLEERGKVVTAQRAVRRWLAHRHKAASVIQLTVRKFLDVKRQQRV
QRGIVKAQALWRAHCSRQHHDNAKLVKLRHRLRQISAEVREEDKLCNKTSSALDYLLRYK
HFSYILEALQNLETATRLSPECCERLVQSGATNVIFTLIRCCNRSVPCMDVITFSIQILL
NLSKYQKTIEAVYSVENSVETLLDLLQRYREKAGDKVAEKGGSIFTKACFLLALLLQDKR
RAEAVMKLPKALDRIRSIYRLTARKHKMDAERTITKQKMNASINGSFFVPATPRKSRPAP
KFAPEWVLRKDKLKDIVDPLRAIHMVADTLSIVL
Download sequence
Identical sequences H2M9T3
ENSORLP00000015275 8090.ENSORLP00000015275 ENSORLP00000015275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]