SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000015350 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000015350
Domain Number 1 Region: 119-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.85e-152
Family Calponin-homology domain, CH-domain 0.00000000807
Further Details:      
 
Domain Number 2 Region: 5-89
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000207
Family Calmodulin-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000015350
Sequence length 633
Comment (Oryzias latipes)
Sequence
MANHVTQISKVDLKELEEAFEKIDIDKSGFVSDYELQELFREASVYLPGYKVRDIIETFI
SGDTNKDQKISFEEFVYIYQKLKSQELSDSFRKVLSKKDGIHSFGGTSDISSEGTQHSYA
DEEKVAFVNWINKALKNDPDCHHVLPMNPNDESLFSSLRDGILLCKMINFSQPDTIDERV
INTKKLTTFKMTENLILALNSASAIGCRVVNVDAHDLKAGKPHLVLGLLWQVIKVGLFAD
IELSKNEDLIALLEDGEKLEHLMSLSPEELLLRWVNYHLQNAKTQKIRNFSDDIKDSRAY
FHLLNQLAIEEMLENKRGIRIDMGGLSEFNLERRAELMLQQAAKMDCRQFVSPRDITAGN
SKLNLAFVANLFNMHPGLRGAKANKGNWDSIEAETREEKTFRNWMNSLGVSPSVNHLYWD
LCDGLVILQLMEKVKVPVNWKKVNNPPFSMLGGNMKKLENCNYAVQLGKNVAHFSLVGVG
GENLNEGSRVHTLALVWQLMRRYTVMVLSDLGDGEKIGDQIILNWVNTTLGQKKKASQIS
NFKDKLISTSMPVFDLIDCIVPGAVKWDMVKKDARGKMSNEDKLDNAKYAISLARKIGAR
VYALPDDLVEVNPKMVMTLFACLMGYGYKKTTK
Download sequence
Identical sequences H2MA04
XP_011488484.1.28442 XP_020569355.1.28442 ENSORLP00000015350 ENSORLP00000015350 8090.ENSORLP00000015350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]