SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 8090.ENSORLP00000017985 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8090.ENSORLP00000017985
Domain Number 1 Region: 1-225
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.52e-76
Family Calponin-homology domain, CH-domain 0.00000135
Further Details:      
 
Domain Number 2 Region: 2987-3111
Classification Level Classification E-value
Superfamily EF-hand 9.73e-47
Family EF-hand modules in multidomain proteins 0.0000056
Further Details:      
 
Domain Number 3 Region: 3112-3208
Classification Level Classification E-value
Superfamily EF-hand 5.44e-37
Family EF-hand modules in multidomain proteins 0.0000138
Further Details:      
 
Domain Number 4 Region: 1984-2141
Classification Level Classification E-value
Superfamily Spectrin repeat 4.68e-25
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 3189-3276
Classification Level Classification E-value
Superfamily RING/U-box 1.77e-22
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 342-449
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-20
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 399-557
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-20
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 519-661
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-18
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 9 Region: 2658-2786
Classification Level Classification E-value
Superfamily Spectrin repeat 1.66e-16
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 10 Region: 1515-1667
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000194
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 11 Region: 2803-2942
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000055
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 12 Region: 1223-1356
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000144
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 13 Region: 2433-2590
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000203
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 14 Region: 2949-2986
Classification Level Classification E-value
Superfamily WW domain 0.0000000000504
Family WW domain 0.00022
Further Details:      
 
Domain Number 15 Region: 705-820
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000196
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 16 Region: 1148-1257
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000288
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 17 Region: 1644-1767
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000637
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 18 Region: 1043-1141
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000245
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 19 Region: 2151-2254
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000059
Family Spectrin repeat 0.0095
Further Details:      
 
Weak hits

Sequence:  8090.ENSORLP00000017985
Domain Number - Region: 2208-2349
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00781
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 8090.ENSORLP00000017985
Sequence length 3558
Comment (Oryzias latipes)
Sequence
DEHDAVQKKTFTKWINAQFSKTGKTSIRDMFTDLRDGTKLLDLLEGLTNTVQTKERGATR
VHALNNVNKVLQVLHQNHVDLVNIGGTDIVDGNHKLTLGLIWSIILHWQVKDVMKDIMSN
LQQNNSEKILLSWVRQCTRSYPEVNVLNFTTSWSDGLAFNGILHHFRPEAFSWDQVVRLS
PMERLDHAFTVARDQLGIERLLDPEDVAVQLPDKKSIIMYVTSLFAVLPKDVSMDAIREV
ETLPRKFKTEDAVPGLSVQVTENKPWNIKHKFRVTQDICINRHQGRFLVPKQPLHTPWNK
RWKIHLNSGRSNKKFIFLEHFSPNRKYNAAGKLQFPPEDVDLDTYQTTLEEVLTWLLSAE
DTLQIQEEVSNDVEEVKEQFHTHEAFMMELTAHQSSVGNVLQAGNQLIAQGSLTEEEEEE
IREQMSLLNSRWENLRVASMDRQARLHEVLMDLQQQQLQQLSDWLTQTEKRIKRIEMEPA
PEDMEVYKEKIEQHKELQNDLEVEQVKVNSLTHMVVVVDENSGESTTAALEEQLQSLGER
WAAVCRWTEEKWQKLQEVFLVWQQLLSDQSLFTEWLAEKEEALNEVQTRNFKDSSEMNTN
VRQLAILKEDMEKKRRTLDKLAEAGQDVIQLLQNPTAGARIEGDTEELTHRWDNLVQKLQ
DCSFQVGVYSEVMESVTDAGITQMDVAMVASTVDQDLEPPAPAKKRLVETSAETLQRFEN
KTSDLLSWIRACKTSTQALATTPAENTPDSPDLSKKFKDVEQEVSAKEATVLEVIQEGQG
LVEQLERESENMESVRTNVDLIQTEWDSCKREVQAARERVHTQSRVRAAAEEVAEVDRLV
EEHDRWLKGSATVEKCSEVDLTNMSGECRSRLVQMDSFSPRLEQLFAEAGGLAAASSLKD
SVLLVSAHHASTLQQLQRREQQVNEALTKLKVTQVAENVLEDLEVRLAALREEVVDLPTT
EKAVEQAQVRVFTETKCHCTVSDHLEETLKESFERPRPQIEQTQQASDSGELQKWSQLSS
RAREEHGTLHCILGCMKDNQVCLEQVQCWFDAVQELLFRDTTGLGDGENLHEELSRCKEY
VNEMESVERSLKQMEENVKAVQAIAVPGLAKWGQDRLEECQERWAELSAQLLSHQEHTAE
SQEKQVNLKKDLGEMQEWMAQVDEEFLMRDFEYKSPEDLEVSLEEMKRAKEDVLQKEVKV
KILKDNINTLVSRTAHLGDGFGQELTFELEGVLANYNKLCDRLKSKCHTLEEVWSCWMEL
LQFLDTEQSWLTSLEEKLHATENLPESTEAVNEALESLEDVLRHPGDNRTQIRELGQTLV
DGGILDELISEKLEAFNSRFEHLHHQAVDRQSSLEQQLQTLKENQQALQNFQESVSQLDH
TLTSYLTDRVDAIQLPQEAQSIAAEIAELEVTMEDMKRRNVFNLPPPAADAKAARGGTML
DQLQRKLREISTKYQLFQKPANFEQRMLDCRRVLEGAKTELHVLDVKDLEPEKIQTHLAG
CMKLYKLLSEVKLEVETVIKTGRQIVQKQQTENPKAMDEQLTALKLLYNNLGAQVTEGKQ
DLEKALLLSQKFQKESSALQDWLTTNEAELQQKNSSGDMPANIDAEIIWANGLLKESERR
KAELSSMTETSAGLQTLVEGSEGQLENRLSSLDEAWGRVRTLTEDWLSTVLSHQNEVEIF
DENVAHISTWLYQTQIHLDEAEHLAPAEKENVLKRILEELDDISLRVDSIRDQAVILMTS
RGPACRDVVEPKLAELNCNFDKVSEHIRTAKLPKTVVRTEIKELRAELQDTLQTLQQQDT
VNLQDDEKMDAEKANMEELLRRGEELLQQTSEEDEREELRVMLLRLQSQYSAHRELMMRR
FVEMKGPLEAPSSHFEERTSELSAQGFGQIFLVVLQVQILFTVFWTSRTFLLVLMQEMSA
SGLSSSPSLTPSDYLLEINKVLLAMADNELLLNSSELSGGLYEDFSSQEDTLQIIQESLE
NLGDKVTGIHERHPDVIQEASHAEAAQIGDALAQLDAEWDRLNRMYNHRKGSFDRAVEEW
EQFHCDLKELSQWLTDAETLLSEGMGADGPPDLKSARQQQAELEEGLASHQAVLSGLNRT
GKQIIGKLSSPDGSLLEDKLETLGQRWRAVQQQFSDRQRRLPGGDSSVADLVRRREELAE
WLEQAENAVHSLPVSATDHNFKELKVQQNVCFIQSHFALAEEMDAQNEQLGWVNKHASQI
LASPSLSPLTRDQHLGKLRSINLKWSKVTELLNKVGEVETNLQSHAQFQDRVNRLSDWVV
VTNQTITSQGLNSVQAQALETSMKDRKKDLEELLAHSIELQRQQQLLPLEKGKVEHLASA
WKTLDGQLRESLQPTMSPWTHQHEDPHIRAQDTPDSVRPTDLNQRATELADWLILVTQML
KSNIVTVGDTNEIRTVIGRLQVTKVDLEQRHSQLEDIFTLAQNIKNKTSDVDVRTSITEK
LERVRSQWDSTQHGVEARLLQLDNMTGHSNQWEEHRKEVTALVGHTDGHFQKLLQRSRDP
LTKQFEDSKDFLQTLGRGQAMVAAFNELSNQLLQEYSSDDTRRVKEVSEKLSVAWKTISS
RASERHNELDSQLKEVQVSLKDVESSLRWLQEAETTVNVLADASRKEDVSQDSTHTKQLS
SWKDDIQAEIDSHNDIFKSVEGNKSKMVKALGSSEEAVFLQHRLDDMNQRWSDLKAKSAN
IRAHLEASAERWSHLLSILEELWRWICMKDEELAKQMPIGGDVPTLLQQQNHCTALCSEL
KEREQLVINALDQARMFLADQPIEGPXNKQTYPTPEEKARGLARAIRKQTVEVKERWARL
KDHVGGWQNQVEKALERLQDLQSSMDQLDLRLTRAEEAKASWQPVGDLLIDSLQDHIDNT
IAFRDEVAPLRQDIRIVNELSAELTPLDIQLSSTASRQLDQLNMRWKLLQVAVEDRLKLL
QEAHRDFGPSSQHFLSTSVQLPWQRAVSQNKVPYYINHQTQTTCWDHPKMTELYQSLADL
NNVRFSAYRTAMKIRRLQKALCLDLLDIGVAQNTFEQLKLTNNSQPLSVPDVINCLTSVY
DGLEQEYKDLVNVPLCVDMCLNWLLNVYDTGRSGKIRTLSMKIGLLSLSKGHLEEKYKHL
FSQVASAGGTCDQRQLGLLLHEAIQIPRQLGEVAAFGGSNIEPSVRSCFQHVNNKVEIDP
RQFVDWMHLEPQSMVWLPVLHRVAAAETAKHQAKCNICKECPIVGFRYRSLKHFNYDVCQ
SCFFSGRTAKGHKLNHPMVEYCTPTTSGEDMRDFTKVLKNKFRSKKYFTKHPRLGYLPVQ
TVLEGDNMETPVTLISMCPEQYELSQSPQLSHDDTHSRIEQYASRLAQMERSNGSLPTDS
SSATGSMDDEHALIIQYCQTLGGEGSLSSQPQSPAQILQAVEKEERGELEKIIARLEEEQ
RTLQREYELLKEQHGQRGAPSGSLSEASSAHPDEADLLAEAKLLRQHKGRLEARMHILED
HNKQLESQLHRLRQLLHQPEVDSRVNGASSPAVQDRGPLTENSDGQNTESLQPYELLDPH
NSSSDLADVMEQINSSFP
Download sequence
Identical sequences H2MH86
ENSORLP00000017985 8090.ENSORLP00000017985 ENSORLP00000017985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]